KEGG   Bacillus subtilis subsp. subtilis 168: BSU27940Help
Entry
BSU27940          CDS       T00010                                 

Gene name
rpmA
Definition
(RefSeq) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU27940 (rpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU27940 (rpmA)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU27940 (rpmA)
  Bacteria
    BSU27940 (rpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L27
Motif
Other DBs
NCBI-GeneID: 937511
NCBI-ProteinID: NP_390672
Pasteur: BG10335
BSORF: BG10335
UniProt: P05657
Position
complement(2854880..2855164)
Genome map
AA seq 94 aa AA seqDB search
MLRLDLQFFASKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPVAQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgcttagattagatcttcagtttttcgcttctaaaaaaggagtaggttctacaaagaac
ggacgtgactctgaggctaaacgtttaggtgctaaacgtgctgacggtcaattcgtaaca
ggcggttctatcctttaccgtcaacgcggaacaaaaatttacccaggtgaaaacgtgggc
cgcggcggagatgacactctatttgcgaaaatcgacggaactgttaaattcgaacgtttc
ggccgtgaccgcaaaaaagtgagcgtatatcctgtagctcaataa

DBGET integrated database retrieval system