KEGG   Bacillus subtilis subsp. subtilis 168: BSU27950Help
Entry
BSU27950          CDS       T00010                                 

Gene name
ysxB
Definition
(RefSeq) hypothetical protein
  KO
K07584  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU27950 (ysxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_Prp
Motif
Other DBs
NCBI-GeneID: 937961
NCBI-ProteinID: NP_390673
Pasteur: BG10334
BSORF: BG10334
UniProt: P26942
Position
complement(2855177..2855515)
Genome map
AA seq 112 aa AA seqDB search
MIQATIRRSHDKGILSFEMTGHANFAEHGQDLVCAGVTAVVFGAVNAVIVLAGFEPLLDI
GEDGGYFYFEFPESLDPEARQKAQLLIEGMIVSLETIERDYKDNLRVTTNII
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcaacaatcagaaggtctcatgataaaggcatattgtcttttgaaatgacg
ggccatgcgaattttgctgaacatggacaagatcttgtttgtgccggagtgacagccgtt
gtgtttggggccgttaacgcggtcattgtgctcgcgggcttcgagccgcttcttgatata
ggagaggacgggggttatttttattttgaattccctgaatctcttgatccagaggcacgc
caaaaagctcagctgctgattgaaggcatgattgtttcgctggagacaatcgaacgggat
tacaaagacaacttgcgtgtgaccacaaacataatatag

DBGET integrated database retrieval system