KEGG   Bacillus subtilis subsp. subtilis 168: BSU27960Help
Entry
BSU27960          CDS       T00010                                 

Gene name
rplU
Definition
(RefSeq) 50S ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU27960 (rplU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU27960 (rplU)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU27960 (rplU)
  Bacteria
    BSU27960 (rplU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L21p P30
Motif
Other DBs
NCBI-GeneID: 936368
NCBI-ProteinID: NP_390674
Pasteur: BG10333
BSORF: BG10333
UniProt: P26908
Structure
PDB: 

Position
complement(2855518..2855826)
Genome map
AA seq 102 aa AA seqDB search
MYAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDNVKVGNPTVEGATVTA
KVEKQGRAKKITVFRYKPKKNVHKKQGHRQPYTKVTIEKINA
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcaatcattaaaacaggcggtaaacaaatcaaagttgaagaaggccaaactgtt
tacatcgaaaaacttgctgctgaagcaggtgaaacagttacttttgaagacgttttgttt
gttggcggagacaacgtgaaagtcggcaaccctacagttgaaggcgcaacagtaacggct
aaagttgaaaaacaaggccgcgcgaaaaaaatcactgttttcagatacaaaccaaagaaa
aacgttcataaaaaacaaggtcatcgtcagccttacactaaagtgacgatcgaaaaaatc
aacgcgtaa

DBGET integrated database retrieval system