KEGG   Bacillus subtilis subsp. subtilis 168: BSU27970Help
Entry
BSU27970          CDS       T00010                                 

Gene name
spoIVFB
Definition
(RefSeq) stage IV sporulation protein FB
  KO
K06402  stage IV sporulation protein FB [EC:3.4.24.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU27970 (spoIVFB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BSU27970 (spoIVFB)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M50: S2P protease family
   BSU27970 (spoIVFB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M50
Motif
Other DBs
NCBI-GeneID: 937505
NCBI-ProteinID: NP_390675
Pasteur: BG10332
BSORF: BG10332
UniProt: P26937
Position
complement(2855973..2856839)
Genome map
AA seq 288 aa AA seqDB search
MNKWLDLILKIHVHPFLWIIAALGLLTGHMKALLCLLLIVLIHELGHAALAVFFSWRIKR
VFLLPFGGTVEVEEHGNRPLKEEFAVIIAGPLQHIWLQFAAWMLAEVSVIHQHTFELFTF
YNLSILFVNLLPIWPLDGGKLLFLLFSKQLPFQKAHRLNLKTSLCFCLLLGCWVLFVIPL
QISAWVLFVFLAVSLFEEYRQRHYIHVRFLLERYYGKNRELEKLLPLTVKAEDKVYHVMA
EFKRGCKHPIIIEKSGQKLSQLDENEVLHAYFADKRTNSSMEELLLPY
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaatggctcgaccttatcttaaagatccatgtgcatccttttctttggattatt
gcggcgctgggcttgctcacaggccatatgaaagcattattatgtctgctcctgattgta
ttgattcatgagctggggcatgctgctctggctgtgtttttttcttggagaatcaagcgt
gtttttttgctgccgtttggcggaacggtcgaagtggaagagcacgggaatcggccgtta
aaggaagagtttgcggtcattattgccggacctcttcagcacatctggcttcagtttgcc
gcctggatgcttgcagaagtctcagtgattcatcagcatacctttgaactcttcaccttt
tataatctttctatcttatttgtcaatttactgccgatctggccgctggatggaggaaaa
ctgttatttttgttgttttccaaacagctgccttttcaaaaggctcaccggcttaatcta
aaaacgtcgctctgcttctgcctgctgctcgggtgctgggttttattcgtgattcctctg
caaatcagcgcatgggttttgtttgtctttctggctgtttccttgtttgaggaatatcgg
caaaggcactatatccatgtgagatttctcctcgaaaggtattacggaaaaaacagggag
cttgagaaacttctgccgctgacagtaaaggcggaggataaagtctatcatgtgatggcc
gagttcaaacgtggctgtaagcatccgattattatagaaaaatcaggccaaaagctcagc
cagcttgacgagaatgaagtgctgcacgcttactttgccgataagcggacgaattcttcc
atggaggaactgcttctgccctactaa

DBGET integrated database retrieval system