KEGG   Bacillus subtilis subsp. subtilis 168: BSU27980
Entry
BSU27980          CDS       T00010                                 

Symbol
spoIVFA
Name
(RefSeq) stage IV sporulation protein FA
  KO
K06401  stage IV sporulation protein FA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU27980 (spoIVFA)
SSDB
Motif
Pfam: Peptidase_M23 Myco_19_kDa
Other DBs
NCBI-GeneID: 937501
NCBI-ProteinID: NP_390676
Pasteur: BG10331
BSORF: BG10331
UniProt: P26936 A0A6M3ZES0
Position
complement(2856832..2857626)
AA seq 264 aa
MSHRADEIRKRLEKRRKQLSGSKRFSTQTVSEKQKPPSWVMVTDQEKHGTLPVYEDNMPT
FNGKHPLVKTDSIILKCLLSACLVLVSAIAYKTNIGPVSQIKPAVAKTFETEFQFASASH
WFETKFGNPLAFLAPEHKNKEQQIEVGKDLIAPASGKVQQDFQDNGEGIKVETSSDKIDS
VKEGYVVEVSKDSQTGLTVKVQHADNTYSIYGELKDVDVALYDFVDKGKKLGSIKLDDHN
KGVYYFAMKDGDKFIDPIQVISFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagtcacagagcagatgaaatcagaaaacgattagagaaaagaagaaagcagctttcc
ggctcaaaacgtttctctactcagacagtttctgaaaagcagaaacccccgtcctgggtg
atggtaacggatcaggaaaagcatggaacacttccggtctacgaagataacatgccaaca
ttcaacggaaaacacccattggtgaaaacagattcaattatcctgaaatgtcttctgtcg
gcctgccttgttctcgtttcagctatagcctataaaacaaacattggacccgtcagtcag
attaaacccgccgtagccaaaacctttgaaactgaatttcaatttgcttcagcaagccat
tggttcgaaaccaaattcggaaatccgcttgctttcctggctcctgaacacaaaaataag
gaacagcagattgaagtaggcaaagatctgatcgcgcctgcatccgggaaagtacagcag
gattttcaggacaatggggaaggaattaaagtcgaaacaagcagtgataagattgatagc
gtaaaagaaggctatgtggttgaagtcagcaaagacagccaaacgggactgacggttaag
gtgcagcatgctgacaacacctatagtatctatggcgagctcaaagatgtggatgttgct
ttatatgattttgtggataaaggcaaaaagctcggttcgattaagcttgatgatcataat
aaaggggtctattattttgccatgaaagacggcgataaatttattgatccgattcaggtg
atttcatttgaataa

DBGET integrated database retrieval system