KEGG   Bacillus subtilis subsp. subtilis 168: BSU28000Help
Entry
BSU28000          CDS       T00010                                 

Gene name
minC
Definition
(RefSeq) septum site-determining protein MinC
  KO
K03610  septum site-determining protein MinC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU28000 (minC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU28000 (minC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    BSU28000 (minC)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   BSU28000 (minC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MinC_C
Motif
Other DBs
NCBI-GeneID: 937500
NCBI-ProteinID: NP_390678
Pasteur: BG10329
BSORF: BG10329
UniProt: Q01463
Structure
PDB: 

Position
complement(2858584..2859264)
Genome map
AA seq 226 aa AA seqDB search
MKTKKQQYVTIKGTKNGLTLHLDDACSFDELLDGLQNMLSIEQYTDGKGQKISVHVKLGN
RFLYKEQEEQLTELIASKKDLFVHSIDSEVITKKEAQQIREEAEIISVSKIVRSGQVLQV
KGDLLLIGDVNPGGTVRAGGNIFVLGSLKGIAHAGFNGNNQAVIAASEMLPTQLRINHVL
NRSPDHIQKGNEMECAYLDTDGNMVIERLQHLAHLRPDLTRLEGGM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccaaaaagcagcaatatgtaacaataaaaggaacaaagaatggactaacattg
catctggatgatgcgtgttcttttgatgagcttctcgatggtcttcagaatatgctgtca
attgaacaatataccgatggaaaaggccagaaaatcagcgttcatgttaagctgggaaat
cgctttttatataaggagcaagaggaacagctaaccgaattgattgcgtcaaagaaagat
ttgtttgttcattctattgacagtgaagtcattactaaaaaagaagcacagcagataaga
gaggaagccgaaattatttctgtttcaaaaattgtccgttcaggccaagtgctgcaggta
aaaggcgacttgctcctgatcggtgacgtgaatcccggcggaacagtcagggccggaggg
aacatttttgttctgggctcactgaaaggaattgcgcatgctggattcaatggaaataat
caagcggtcatcgccgcctctgaaatgcttccgacacaattaagaatcaatcatgtgtta
aatcgctccccagaccacattcaaaaagggaacgaaatggaatgtgcttatttagataca
gacggaaatatggtcattgaacgccttcaacatttggctcatttaagacctgatctaaca
aggcttgagggaggaatgtga

DBGET integrated database retrieval system