KEGG   Bacillus subtilis subsp. subtilis 168: BSU28010
Entry
BSU28010          CDS       T00010                                 

Gene name
mreD
Definition
(RefSeq) rod shape-determining protein MreD
  KO
K03571  rod shape-determining protein MreD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU28010 (mreD)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU28010 (mreD)
SSDB
Motif
Pfam: MreD
Other DBs
NCBI-GeneID: 936183
NCBI-ProteinID: NP_390679
Pasteur: BG10328
BSORF: BG10328
UniProt: Q01467 A0A6M3ZJQ2
Position
complement(2859317..2859835)
AA seq 172 aa
MKRFLLPFVMMLVFSAESIFTDLVHFPFVTDDQVLAPRFLMLVLIFMSAFINQKHAMIYG
FIFGFLYDMNYTSLLGVYMFGFAGLCYLASKAFKVLHTNAFVVILIAVLAVCLLEFYVFG
IQSLIHKDIMTFNGFVLDRFIPTILLNIAAALILVLPFRLFFMSLKKELRDE
NT seq 519 nt   +upstreamnt  +downstreamnt
gtgaaacgtttccttctccctttcgttatgatgcttgttttttctgcggaaagcattttt
acagatttggtgcattttcctttcgttacagatgaccaagtgctcgccccgcgttttttg
atgcttgtattgatattcatgtcggcttttatcaaccaaaaacacgcgatgatttacgga
tttatttttggctttctatatgacatgaactatacaagtctattaggcgtttacatgttt
ggttttgcagggctatgctatttggcttcaaaagcgtttaaagtgttgcatacaaacgca
tttgtagtgatattgatagcagttctggctgtctgtctgctcgaattttacgtattcggc
attcagtctttgattcataaagacattatgacgtttaacggatttgtgcttgaccggttt
ataccgacaattttattaaatattgcagcagctcttattcttgttctgccatttagattg
ttttttatgagtctaaagaaagaattgagagatgagtaa

DBGET integrated database retrieval system