KEGG   Bacillus subtilis subsp. subtilis 168: BSU28040Help
Entry
BSU28040          CDS       T00010                                 

Gene name
radC
Definition
(RefSeq) hypothetical protein
  KO
K03630  DNA repair protein RadC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU28040 (radC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RadC HHH HHH_2 Prok-JAB HHH_3 HHH_5 Transposase_20
Motif
Other DBs
NCBI-GeneID: 936544
NCBI-ProteinID: NP_390682
Pasteur: BG10325
BSORF: BG10325
UniProt: Q02170
Position
complement(2861840..2862535)
Genome map
AA seq 231 aa AA seqDB search
MVIHDLPLKLKDFPMKEKPRERLLKVGAENLANHELLAILLRTGTKHESVLDLSNRLLRS
FDGLRLLKEASVEELSSIPGIGMVKAIQILAAVELGSRIHKLANEEHFVIRSPEDGANLV
MEDMRFLTQEHFVCLYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAFKRSAASFICVH
NHPSGDPTPSREDIEVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttggtcatacacgatctgccattaaaactcaaagatttcccaatgaaagaaaagccaagg
gaacggctcctgaaagtcggagccgagaacttagcgaatcatgaacttttggctatatta
ttgcggacagggactaaacacgaatctgttttggacctgtcaaaccggctgctgcgctca
tttgacgggctgcgcctgctcaaggaagcatcggttgaagagctgtcaagcatcccggga
atcggtatggtaaaagcgattcaaatactggcagcagttgagcttggaagccggattcat
aaattagccaacgaagaacatttcgttattcgctccccggaagacggcgctaatcttgtc
atggaggatatgcgctttttaacccaggagcattttgtctgtttatacttaaatacaaaa
aatcaagtcatccataaacgcaccgtatttatcggaagcctgaattcatctattgtccac
ccgcgagaggtgtttaaagaagcgtttaaacgatctgccgcttcctttatctgtgttcat
aatcatccttctggagatccgacgccgagcagggaagatattgaagtgacaagacggctg
tttgaatgcggaaacctgattggcatcgagctgcttgaccatttggtgatcggggataaa
aaatttgtgagtttaaaggaaaaaggatatttgtaa

DBGET integrated database retrieval system