KEGG   Bacillus subtilis subsp. subtilis 168: BSU28050Help
Entry
BSU28050          CDS       T00010                                 

Gene name
maf
Definition
(RefSeq) septum formation protein Maf
  KO
K06287  septum formation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU28050 (maf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf
Motif
Other DBs
NCBI-GeneID: 936605
NCBI-ProteinID: NP_390683
Pasteur: BG10324
BSORF: BG10324
UniProt: Q02169
Structure
PDB: 

Position
complement(2862572..2863141)
Genome map
AA seq 189 aa AA seqDB search
MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADL
HPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYD
KTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMR
ALRHFDIRA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccgctaatacttgcatcacaatctccgcgcaggaaagaactcctcgatctt
ctccagctgccctactccattattgtcagtgaagtagaagaaaaattaaatcgaaacttt
tcaccagaagaaaacgtccaatggttggcaaaacaaaaagctaaggctgtagctgatctc
cacccgcatgcaatcgttatcggtgctgatacaatggtatgccttgacggcgaatgtctt
ggcaaaccgcaggatcaagaagaagctgcttctatgctgcggaggctttcaggccgaagt
cactcagtaataaccgcggtcagcattcaagctgaaaatcacagcgagactttttatgat
aagacagaagttgcgttttggtccctcagtgaagaagagatttggacatatattgaaaca
aaagagccgatggataaagcaggtgcatacggcatccaaggaagaggcgcgctttttgta
aagaaaatagacggagattattattcagtcatgggccttcctatatcaaaaacaatgaga
gctcttcgccattttgatataagggcatga

DBGET integrated database retrieval system