KEGG   Bacillus subtilis subsp. subtilis 168: BSU28050
Entry
BSU28050          CDS       T00010                                 
Symbol
maf
Name
(RefSeq) septum formation protein Maf
  KO
K06287  nucleoside triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU28050 (maf)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-
     BSU28050 (maf)
SSDB
Motif
Pfam: Maf
Other DBs
NCBI-GeneID: 936605
NCBI-ProteinID: NP_390683
Pasteur: BG10324
UniProt: Q02169 A0A6M4JK08
Structure
Position
complement(2862572..2863141)
AA seq 189 aa
MTKPLILASQSPRRKELLDLLQLPYSIIVSEVEEKLNRNFSPEENVQWLAKQKAKAVADL
HPHAIVIGADTMVCLDGECLGKPQDQEEAASMLRRLSGRSHSVITAVSIQAENHSETFYD
KTEVAFWSLSEEEIWTYIETKEPMDKAGAYGIQGRGALFVKKIDGDYYSVMGLPISKTMR
ALRHFDIRA
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacaaaaccgctaatacttgcatcacaatctccgcgcaggaaagaactcctcgatctt
ctccagctgccctactccattattgtcagtgaagtagaagaaaaattaaatcgaaacttt
tcaccagaagaaaacgtccaatggttggcaaaacaaaaagctaaggctgtagctgatctc
cacccgcatgcaatcgttatcggtgctgatacaatggtatgccttgacggcgaatgtctt
ggcaaaccgcaggatcaagaagaagctgcttctatgctgcggaggctttcaggccgaagt
cactcagtaataaccgcggtcagcattcaagctgaaaatcacagcgagactttttatgat
aagacagaagttgcgttttggtccctcagtgaagaagagatttggacatatattgaaaca
aaagagccgatggataaagcaggtgcatacggcatccaaggaagaggcgcgctttttgta
aagaaaatagacggagattattattcagtcatgggccttcctatatcaaaaacaatgaga
gctcttcgccattttgatataagggcatga

DBGET integrated database retrieval system