KEGG   Bacillus subtilis subsp. subtilis 168: BSU28060Help
Entry
BSU28060          CDS       T00010                                 

Gene name
spoIIB
Definition
(RefSeq) stage II sporulation protein B
  KO
K06380  stage II sporulation protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU28060 (spoIIB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOR
Motif
Other DBs
NCBI-GeneID: 937497
NCBI-ProteinID: NP_390684
Pasteur: BG10912
BSORF: BG10912
UniProt: P37575
Position
complement(2863294..2864292)
Genome map
AA seq 332 aa AA seqDB search
MKKRKNKKNSKAAEKALKVTINGKEETVYEQETPETEANKSMTFSNWEEKRQAEQEVAAS
QEHPDEDEFNWDSEEDKVFKEDPKVVPPFQKKKTKLYAKGKTGAAKPVKRVAATIAFAAV
IGTGLGLFALNISGNKEASAPASLEDSLGSQTAKAGDTSADKQTSGAEKQAAQTEGTYKT
YAVQAGKFSNEKGAETLTEQLTEKGYSAVSLSKDDGYTYVIAGLASEKEVSQQLGQVLID
SDFEAWGGKELSLSIESDMTDSFKETAELAAKAILDEDITKASVEKIEKSLGETKASETG
EKKAILQALKELEDPSAEAGWKAQQELLAVVK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaagaaagaataaaaaaaacagtaaagccgcagaaaaagccctcaaggtgacg
attaatggaaaagaagagacggtttacgaacaagagacgcctgagacagaggcgaataaa
agcatgacattttcaaattgggaggaaaaaagacaggcagaacaagaggttgcggcatcc
caggaacaccctgatgaagatgaattcaattgggattccgaggaggacaaggtgtttaaa
gaggaccctaaagttgttcctccttttcaaaagaaaaaaacaaagctttacgcaaaagga
aagaccggggctgccaaaccggtaaaaagagtggccgcgacgattgccttcgcggctgtc
attggcactggattagggttattcgcgttaaacatatcggggaataaagaagcgtcagca
ccggcctctttagaggattctttaggcagccaaacggcaaaagcaggggatacttctgct
gataaacaaacctcaggcgcagaaaaacaagcggcacaaactgaaggtacatacaaaaca
tacgctgtgcaagccggaaaattttcaaatgaaaagggcgccgaaacgttaacagaacaa
ttgaccgaaaaaggatattccgccgtgtcactgtcaaaggatgacgggtatacgtatgtt
attgcaggcttagcaagtgaaaaggaggtctcacagcagttaggacaggttttaatcgac
agtgattttgaagcctggggaggcaaggagctttccttatcaatagagtcagatatgaca
gattcttttaaggaaacagcggagcttgcagcaaaggcgattctcgacgaagacattaca
aaagcgagtgtagagaaaatagaaaagtcgcttggtgaaacaaaagcgtcagaaacagga
gagaaaaaagcgattttgcaggctttaaaggaattagaggatccaagtgctgaagccggg
tggaaggctcagcaggagctgttagccgtcgtaaaataa

DBGET integrated database retrieval system