KEGG   Bacillus subtilis subsp. subtilis 168: BSU28070Help
Entry
BSU28070          CDS       T00010                                 

Gene name
comC
Definition
(RefSeq) type 4 prepilin-like proteins leader peptide-processing enzyme
  KO
K02236  leader peptidase (prepilin peptidase) / N-methyltransferase [EC:3.4.23.43 2.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU28070 (comC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSU28070 (comC)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.43  prepilin peptidase
     BSU28070 (comC)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BSU28070 (comC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DiS_P_DiS Peptidase_A24 DNA_RNApol_7kD Prok-RING_4
Motif
Other DBs
NCBI-GeneID: 936586
NCBI-ProteinID: NP_390685
Pasteur: BG10323
BSORF: BG10323
UniProt: P15378
Position
complement(2864426..2865172)
Genome map
AA seq 248 aa AA seqDB search
MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGK
CKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIP
NRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIG
FVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIIS
FYIKMALG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctatccattctttttatcttcgggcttatccttggttctttttactatacggccggg
tgccgtatccccttacatctatctattattgcgccccgttcatcatgcccgttttgccgg
cgaacattaactcctgcagaattaattcccatcctgtcattcctatttcaaaaaggtaaa
tgtaaaagctgcgggcataggatttcttttatgtatcccgcagcagagcttgtgacagcg
tgtttatttgccgccgcaggaatacgctttggcatatcgctggaactgtttcccgctgtg
gtgtttatctctcttctcattattgttgcagtgacagatattcattttatgctgattcca
aatcgaatattgattttctttcttccctttttggcggccgcgagattgatttctccgctt
gattcctggtatgcaggcctgttaggtgcggcagccggatttttgtttctggctgtaatt
gccgcaatcacccatgggggagtagggggaggagatattaaattatttgcggtgattggc
tttgtgcttggtgtgaaaatgctggcagctgcctttttcttttcagttttgataggtgca
ttatatggagcggcagctgttctgactggtagactcgctaaaaggcagccgcttcccttc
gcccccgctatagccgcagggagcattttagcctatttatacggtgactctatcatttct
ttttatatcaaaatggcattgggctga

DBGET integrated database retrieval system