KEGG   Bacillus subtilis subsp. subtilis 168: BSU28080Help
Entry
BSU28080          CDS       T00010                                 

Gene name
folC
Definition
(RefSeq) folylpolyglutamate synthase
  KO
K11754  dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU28080 (folC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     BSU28080 (folC)
    6.3.2.17  tetrahydrofolate synthase
     BSU28080 (folC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C DUF3670
Motif
Other DBs
NCBI-GeneID: 936327
NCBI-ProteinID: NP_390686
Pasteur: BG10322
BSORF: BG10322
UniProt: Q05865
Position
complement(2865312..2866604)
Genome map
AA seq 430 aa AA seqDB search
MFTAYQDARSWIHGRLKFGVKPGLGRMKQLMARLGHPEKKIRAFHVAGTNGKGSTVAFIR
SMLQEAGYTVGTFTSPYIITFNERISVNGIPISDEEWTALVNQMKPHVEALDQTEYGQPT
EFEIMTACAFLYFAEFHKVDFVIFETGLGGRFDSTNVVEPLLTVITSIGHDHMNILGNTI
EEIAGEKAGIIKEGIPIVTAVTQPEALQVIRHEAERHAAPFQSLHDACVIFNEEALPAGE
QFSFKTEEKCYEDIRTSLIGTHQRQNAALSILAAEWLNKENIAHISDEALRSGLVKAAWP
GRLELVQEHPPVYLDGAHNEEGVEKLAETMKQRFANSRISVVFSALKDKPYQNMIKRLET
IAHAIHFASFDFPRASLAKDLYDASEISNKSWSEDPDDVIKFIESKKGSNEIVLITGSLY
FISDIRKRLK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgtttactgcatatcaagatgcgcgcagctggattcacgggaggctgaaattcggggtg
aagcccggacttggtcgaatgaaacagctgatggcgcggttaggacatcctgaaaaaaaa
atccgagcgttccacgtcgcaggaacaaacggtaaaggatcaactgtcgcttttatccgt
tctatgctgcaggaagccggatatacggttggaacatttacatcgccttatattattacg
tttaatgaacggatcagcgtaaacgggataccgatttcagatgaggaatggacagcactc
gtcaatcaaatgaaaccgcacgttgaagcccttgatcaaacggaatacggacagccgaca
gaatttgaaattatgacagcttgtgcatttttatattttgcagagtttcataaggtcgat
tttgttatttttgaaacaggtctgggcggtagattcgattctactaatgtggttgaaccg
ctcttaactgtgattacaagcatcggacacgatcatatgaacattttgggaaacaccatt
gaagaaattgcaggagaaaaggccggcattattaaagaaggtattccaatcgttacagca
gttacccagccggaagctttacaggtcatccgccatgaagccgaacggcatgctgcgccg
ttccagtcattgcatgatgcatgtgttattttcaatgaagaggctctgcctgcaggagaa
cagttttcattcaaaacggaagagaaatgctatgaagatattcggacatctctgattggc
acccatcaaagacaaaatgctgctttgtccattttggctgcggagtggctcaataaggag
aatatcgcccatatcagtgacgaagcgttaaggagcgggcttgtgaaggctgcttggccg
ggacggttagagcttgttcaggaacatcctccggtatatttagacggtgcgcataacgaa
gaaggtgttgaaaagctggcggaaacgatgaagcagcgtttcgccaattcacgcatttct
gtggtgtttagcgcgttaaaggacaaaccgtatcagaacatgattaaaagactggaaacc
attgctcatgcgattcattttgcttcttttgatttcccgcgtgcttcccttgcaaaagat
ctctatgatgcaagtgaaatcagcaataaaagctggagtgaagatccagacgatgtaatc
aaattcatagaaagtaaaaagggctcaaatgaaattgtgctgattaccggatctctttac
tttatttctgacattcgaaaaaggttgaaataa

DBGET integrated database retrieval system