KEGG   Bacillus subtilis subsp. subtilis 168: BSU28090Help
Entry
BSU28090          CDS       T00010                                 

Gene name
valS
Definition
(RefSeq) valine--tRNA ligase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Module
bsu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU28090 (valS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU28090 (valS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU28090 (valS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     BSU28090 (valS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BSU28090 (valS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU28090 (valS)
 Prokaryotic Type
    BSU28090 (valS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 937491
NCBI-ProteinID: NP_390687
Pasteur: BG10321
BSORF: BG10321
UniProt: Q05873
Position
complement(2866664..2869306)
Genome map
AA seq 880 aa AA seqDB search
METNEQTMPTKYDPAAVEKDRYDFWLKGKFFEAGSDQTKEPYSVVIPPPNVTGRLHLGHA
WDTTLQDIVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGKSRYDLGREKFLEET
WKWKEEYADFIRSQWAKLGLGLDYSRERFTLDEGLSKAVREVFVKLYEKGLIYRGEYIIN
WDPATKTALSDIEVIYKDVQGAFYHMSYPLADGSGSIEIATTRPETMLGDTAVAVHPEDE
RYKHLIGKTVILPIVNREIPIVGDDYVDMEFGSGAVKITPAHDPNDFELGNRHNLERILV
MNEDGTMNENALQYQGMDRFECRKKLVKDLQEAGVLFKIEDHMHSVGHSERSGAVVEPYL
STQWFVRMQPLADAAIELQKKEEKVNFVPDRFEKTYLHWMENIRDWCISRQLWWGHRIPA
WYHKETGELYVGLEAPEDSENWEQDTDVLDTWFSSALWPFSTMGWPDVTAEDFKRYYPTD
VLVTGYDIIFFWVSRMIFQGIEFTGERPFKDVLIHGLIRDEQGRKMSKSLGNGVDPMDVI
DKYGADSLRYFLATGSSPGQDLRFSYEKVESTWNFANKIWNASRFALMNMDGMTYDELDL
SGEKSVADKWILTRLNETIEHVTQLADRYEFGEVGRHLYNFIWDDFCDWYIEMAKLPLYG
EDEAAKKTTRSILAYVLDQTMRLLHPFMPFLTEEIWQHLPHQGESITVSQWPAVVPEHTD
TEAAADMKLLVELIRSVRNIRSEVNTPMSKQVELYIKTSTDEIASRLEANRSYVERFTNP
SVLKIGTDIEAVDKAMTAVVSGAEVILPLEGLINIDEEIARLQKEFDKLTKEVERVQKKL
GNEGFMKKAPAHVIDEEREKEKDYVAKRDAVQKRMAELKG
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgaatgaacaaacaatgccgacgaaatatgatccggcagcggttgaaaaagac
cgatatgatttttggctaaaaggcaaattttttgaagcgggcagtgaccagacaaaagag
ccatactctgttgtcatcccgccgccaaacgtaacagggagacttcaccttggccacgca
tgggacacaacgctgcaagacattgtaacaagaatgaaacgcatgcagggctatgatgtg
ctgtggcttcctggcatggaccacgccggcatcgcgacacaggctaaagtggaggcgaaa
cttcgtgaagaaggcaaatcccgctacgatttaggccgtgaaaaattcctcgaagaaacg
tggaagtggaaggaagaatatgctgactttattcgcagccagtgggcgaaattaggtctt
ggcctagattattcccgtgaacgttttacgctggatgaaggcttgagcaaagcggtaagg
gaagtattcgttaagctttatgaaaaaggcctgatctacagaggcgaatatattattaac
tgggacccagcgacaaaaacagccctatccgacattgaggtgatttacaaggatgttcaa
ggcgcattctatcatatgagctatccgcttgctgacggttcaggctcaattgaaattgcg
acgacacgtcctgaaacaatgctcggtgatacagctgttgccgttcaccctgaagacgag
cgctataaacaccttatcggaaaaacggtgatcctgccgattgtaaatcgtgaaattccg
attgtcggtgatgactatgttgatatggaatttggttcaggtgccgtgaaaattacgcct
gctcatgatccgaacgacttcgagcttggcaaccgccacaatttagaacgcatccttgtc
atgaatgaagatggcacgatgaatgaaaatgcgctccaatatcaaggtatggatcgtttt
gaatgccgcaaaaagctcgtgaaagatttacaggaggcgggagttctcttcaagatcgag
gatcatatgcactctgtcggccatagtgaacgaagcggggctgttgtggagccttatctt
tctacacaatggtttgtgcgcatgcagccgcttgctgatgcagcgattgagctgcaaaaa
aaagaagaaaaggtcaactttgtgcctgaccgtttcgaaaaaacgtatttacactggatg
gaaaatatccgcgactggtgtatctcccgtcaattgtggtggggccatcgtattcctgcc
tggtatcataaagaaacaggcgagctatatgtcggacttgaagcgccggaagacagcgaa
aattgggaacaggatacagacgtactggatacatggttcagttctgcgctatggcctttc
tccacaatgggctggcctgatgtaacggctgaagactttaaacgctactatccgacagat
gttctcgtgacagggtacgatatcattttcttctgggtatcacgcatgattttccaaggc
attgaatttacaggcgagcgcccgttcaaagatgttttaatccacggcttaatccgtgac
gagcaaggccggaaaatgagtaaatctcttggcaacggtgtcgacccgatggatgtgatt
gacaagtacggagccgattctctgcgttatttccttgcgactggaagctctcctggccag
gatctgcgcttcagctatgaaaaagtggaatcgacctggaattttgccaataaaatttgg
aacgcctcccgttttgcattaatgaatatggatggcatgacgtacgatgagcttgatctg
tcaggtgaaaagtcagtcgctgacaagtggattttaacgcgattaaatgaaacgatcgag
cacgtgacccagcttgctgaccgatatgaatttggtgaagtaggacgccatttatataac
tttatttgggatgatttctgtgattggtatattgaaatggcgaagcttccgctttatgga
gaagacgaagcggctaagaaaactacccgttccatccttgcttacgtacttgatcaaacg
atgcgtctgctccatccgtttatgccattcttaacggaggaaatttggcagcaccttcct
caccaaggggaatcgattacagtaagtcaatggcctgcagtagtgccggagcataccgat
actgaagcggcagctgacatgaagcttcttgttgagctgatccgttctgtgcgcaatatc
cgcagtgaagtcaatacgccaatgagcaagcaggttgaactgtacattaaaacaagcaca
gacgaaatagcgtcccgcctcgaagcgaaccgttcatatgttgaacgctttacgaatccg
agcgtgcttaaaatcggcaccgatattgaggctgttgataaggcgatgacggccgttgtc
tcaggagcagaggttattcttccgcttgaaggcttaatcaatattgatgaagaaattgcc
cgtctgcaaaaagaatttgataaactgacaaaagaagttgagcgtgtccaaaagaaactt
ggaaatgaaggatttatgaaaaaagcgcctgcacacgtaattgatgaagaacgtgaaaaa
gaaaaagattatgtggcgaagcgtgacgctgttcaaaaacgaatggctgagctgaagggt
taa

DBGET integrated database retrieval system