KEGG   Bacillus subtilis subsp. subtilis 168: BSU28099Help
Entry
BSU28099          CDS       T00010                                 

Gene name
yszA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5510
Motif
Other DBs
NCBI-GeneID: 8302989
NCBI-ProteinID: YP_003097770
UniProt: C0H465
Position
2869754..2869945
Genome map
AA seq 63 aa AA seqDB search
MKKRFSSYSLPPWVRQIRLVSAQVIIPITIFQGIRTIFFPTTFDVLLLAILIFLACALHL
EWI
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaacgtttcagctcttattcgctgccgccatgggtaaggcaaattcggcttgta
tccgcacaagtgattattcccattacgatttttcaaggaatcagaaccattttctttccg
acaacctttgatgttttgctgctcgcaatcctaatctttttagcttgcgcccttcattta
gaatggatataa

DBGET integrated database retrieval system