KEGG   Bacillus subtilis subsp. subtilis 168: BSU28100Help
Entry
BSU28100          CDS       T00010                                 

Gene name
ysxE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1428
Motif
Other DBs
NCBI-GeneID: 937496
NCBI-ProteinID: NP_390688
Pasteur: BG10347
BSORF: BG10347
UniProt: P37964
Position
complement(2869964..2870989)
Genome map
AA seq 341 aa AA seqDB search
MEDTQSVLQEYGLTAQFIEPVSPLVWKVYTDYGIFALKKLKEGRGKHFTDHMVAIEEKGF
RSFVPVYRTNSGEFFSAGIQYGDIYYLMPWLQFDQEEERDQKHAYLFRETARLHERTAQE
LKVRRDEIERYYGQTKKKWEQDKIFYEQFVDRAEKEWYLSPFELQAITYFSETISAVNFA
LERLEDWYESAKEKDVSRVVMNHGSLSIHHFLYNDAGTGYFTNFERASVGPPQNDLLGFY
TKMFRGFPKACPECVEWFYGYTKSFPLREAEVSLFLSYMAYPAAMYKVLNGYQTGKRQHE
KEECTQLLKAYWQMKNIEPFVMKIHQIEQEKKFQAENESTS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaagatacccaatcggttcttcaggaatacggactgactgctcaatttattgagcct
gtcagtcctcttgtttggaaagtgtatacagactacggcatatttgccctgaaaaaattg
aaagaaggtcgcggcaagcattttacagatcatatggtggcgattgaggaaaaaggcttt
cgttcattcgttcccgtttacagaacaaatagcggtgagtttttctcagcaggcatacaa
tacggagatatctactatttaatgccttggctccaatttgaccaagaggaagaacgggat
caaaaacatgcttatttatttagagaaacagcccgtcttcacgagagaaccgcgcaggaa
ctaaaggttagacgtgatgagattgaacgttattacgggcaaacgaaaaaaaagtgggaa
caagataaaattttctatgagcagtttgtggatagagcggagaaggaatggtacctttct
ccctttgaactccaggccataacctatttttctgaaaccatttccgcggtgaactttgcg
ctggaacggctggaggactggtatgagtccgcaaaggaaaaggacgtttcaagggttgta
atgaaccacggcagcctgtctatacaccattttctgtataatgatgccgggaccggatat
tttacaaacttcgaaagagcatctgtcggtccgccgcaaaacgacctgctcggcttttat
acaaaaatgttcagaggctttccgaaagcttgtccggaatgcgtcgaatggttttatgga
tatacgaaatcattccctttgcgtgaagcggaagtcagcctttttctcagctatatggca
tatccggcagccatgtacaaggtgctgaacggttatcaaactgggaaaagacagcatgaa
aaagaggaatgtacacaattattaaaggcttattggcaaatgaaaaacatagagccgttt
gtgatgaaaattcatcagattgaacaagagaaaaaatttcaggctgaaaacgagtccacg
tcttaa

DBGET integrated database retrieval system