KEGG   Bacillus subtilis subsp. subtilis 168: BSU28110Help
Entry
BSU28110          CDS       T00010                                 

Gene name
spoVID
Definition
(RefSeq) stage VI sporulation protein D
  KO
K06417  stage VI sporulation protein D
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU28110 (spoVID)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM Binary_toxB_3
Motif
Other DBs
NCBI-GeneID: 936772
NCBI-ProteinID: NP_390689
Pasteur: BG10346
BSORF: BG10346
UniProt: P37963
Position
complement(2871022..2872749)
Genome map
AA seq 575 aa AA seqDB search
MPQNHRLQFSVEESICFQKGQEVSELLSISLDPDIRVQEVNDYVSIIGSLELTGEYNIDQ
NKHTEEIYTDKRFVEQVRKREDGSAELTHCFPVDITIPKNKVSHLQDVFVFIDAFDYQLT
DSRILTIQADLAIEGLLDDTQDKEPEIPLYEAPAAFREEELSEPPAHSVVEEPGASSAEE
AVLQHEPPAEPPELFISKAGLREELETEKAESEPPESVASEPEAREDVKEEEESEELAVP
ETEVRAESETEESEPEPDPSEIEIQEIVKAKKETAEPAAAIADVREEADSPAETELREHV
GAEESPALEAELHSETVIAKEKEETTVSPNHEYALRQEAQNEEAAQSDQADPALCQEEAE
PDEALESVSEAALSIEDSRETASAVYMENDNADLHFHFNQKTSSEEASQEELPEPAYRTF
LPEQEEEDSFYSAPKLLEEEEQEEESFEIEVRKTPSAEEPKEETPFQSFQLPESSETERK
ETDAVPRVAPAAETKEPQTKESDNSLYLTKLFTKEADEFSRMKICIVQQEDTIERLCERY
EITSQQLIRMNSLALDDELKAGQILYIPQYKNSHA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaaaatcatcgattgcaattttctgtagaagaatcgatctgtttccaaaaagga
caggaagtttctgaactgctttctatttcattagatcctgatattagggttcaggaagta
aatgattatgtatcaatcataggatcgcttgaacttacaggtgagtacaacatagatcaa
aacaaacataccgaagagatttatacagataagcggtttgttgaacaagtcagaaagaga
gaggatggaagtgcggaactgactcactgttttcctgtggatattaccattccgaaaaat
aaagtgagccatttacaggatgtcttcgtctttattgacgcatttgactatcaattgacg
gattcgcgcattttaacaattcaagctgatttagcgatcgaagggcttttggacgatacg
caagacaaagagccggagatacctttatatgaagctcctgcggcattcagggaggaagag
ctttcagagccgccggcacatagtgtagtagaagaaccgggtgcatcatcggcagaggaa
gcagttcttcagcatgaaccgccagccgaaccgccagaactttttatctcgaaagcgggg
ctccgtgaagaactggagacagaaaaagcagaatctgagccgcctgaatcggttgcttca
gaaccagaggccagagaagatgtgaaagaggaagaagagtcagaagagcttgctgtgccg
gaaacggaggttcgtgctgaatcggaaacagaagaatctgagccagaacctgatccttca
gaaatagagattcaagagatcgttaaagcaaaaaaagaaacggcagagccggcagctgca
atagcggatgttcgtgaagaagcagactctccagcggagactgagcttcgtgaacacgtt
ggagcagaagaatcgcctgctttggaagctgagcttcattcagagactgtgattgcaaag
gaaaaagaggaaacaacagtgtctcctaatcatgaatatgcgctgcgccaagaggctcaa
aatgaagaagcagctcaatcggatcaggctgatcctgcgctttgccaagaagaggcggaa
ccggatgaagctttggagagtgtatcagaggccgctctctccatagaagatagcagagaa
acagcttcagctgtatatatggagaatgacaatgccgatttacatttccatttcaatcaa
aaaacaagctcggaggaggcatctcaagaagaattgcctgaaccggcataccgtaccttc
ctgcctgaacaagaagaggaggattctttttattcagcgcctaagctgctggaggaggaa
gaacaagaggaagagagcttcgaaattgaagtgagaaaaacaccatcagctgaagagcct
aaggaagaaacaccttttcaatccttccagctgcctgaatcttctgagactgaaaggaag
gaaacggatgctgttcctagggttgctcctgctgctgaaacgaaggaacctcaaacaaag
gaaagtgataattctctttatttaacaaaactctttacaaaagaagcggatgagttttcg
agaatgaaaatttgtattgtgcagcaggaagatacgatcgagcgtttatgcgaacggtat
gaaattacatcccagcagctgatcaggatgaattctttagccttggatgatgaattaaaa
gcaggacagattctctatattcctcaatataaaaatagccatgcgtaa

DBGET integrated database retrieval system