KEGG   Bacillus subtilis subsp. subtilis 168: BSU28120Help
Entry
BSU28120          CDS       T00010                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28120 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU28120 (hemL)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BSU28120 (hemL)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU28120 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 937490
NCBI-ProteinID: NP_390690
Pasteur: BG10345
BSORF: BG10345
UniProt: P30949
Structure
PDB: 

Position
complement(2872880..2874172)
Genome map
AA seq 430 aa AA seqDB search
MRSYEKSKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVL
SWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTE
ATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTI
TVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFD
EVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGT
LSGNPLAMTAGLETLKQLTPESYKNFIKKGDRLEEGISKTAGAHGIPHTFNRAGSMIGFF
FTNEPVINYETAKSSDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAA
EKVFAEISRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaagctatgaaaaatcaaaaacggcttttaaagaagcgcaaaaactcatgccgggc
ggtgtgaacagtcccgttcgcgcatttaaatcggtagacatggacccgatttttatggag
cgcggaaaaggctcgaaaatctttgatattgacgggaatgaatatattgactacgtcttg
tcatgggggcctttaattttagggcatacaaatgaccgcgtcgtagaaagcctcaaaaaa
gtggctgaatacgggacaagctttggtgctccgactgaagtagaaaatgaactggctaag
ctcgtcattgatcgtgtgccatctgtagaaattgtacgaatggtaagctccggaacagag
gctacaatgagtgccctccgtttggcaaggggctatacgggccgcaacaagattttaaaa
tttgagggctgctaccacggacacggcgattctctcttgattaaagctggttcaggtgtt
gccactctcggtctgcctgacagcccgggggtgcctgaaggcattgcgaaaaacaccatc
accgttccgtacaatgatttagaaagtgtaaagcttgctttccagcaattcggtgaagac
attgcgggagtcattgtagagccagttgccggaaatatgggtgttgttccgccgcaagaa
ggtttccttcagggtctgcgtgatatcactgagcagtacggctccctgctgatttttgat
gaagtgatgactggcttccgggtcgattataactgcgctcaaggctacttcggcgtaacg
cctgatctgacttgtttaggaaaagtaatcgggggcggacttcctgtcggcgcttatggc
ggaaaggcagaaatcatggagcagatcgctccaagcggtccgatctatcaagctggtaca
ttgtcaggcaacccgcttgcgatgacggctggcttagagacattgaaacagctgacacct
gaatcctacaagaatttcatcaaaaaaggcgacagactggaagaaggaatttcaaaaacc
gccggggctcatggcattccgcatacctttaaccgtgcaggttcgatgatcggtttcttc
tttacaaacgaaccagtcatcaattatgaaacagcgaaatcatctgatttgaagctgttc
gcaagctattataaagggatggcaaatgaaggggtattccttccgccatcacaattcgaa
ggtcttttcctctcaacggcccatactgatgaagatattgaaaacacaatccaggcagct
gagaaagtatttgctgagatcagccgcagataa

DBGET integrated database retrieval system