KEGG   Bacillus subtilis subsp. subtilis 168: BSU28120
Entry
BSU28120          CDS       T00010                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28120 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU28120 (hemL)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BSU28120 (hemL)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU28120 (hemL)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 937490
NCBI-ProteinID: NP_390690
Pasteur: BG10345
BSORF: BG10345
UniProt: P30949
Structure
PDB: 
3BS8

Position
complement(2872880..2874172)
AA seq 430 aa
MRSYEKSKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVL
SWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTE
ATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTI
TVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFD
EVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGT
LSGNPLAMTAGLETLKQLTPESYKNFIKKGDRLEEGISKTAGAHGIPHTFNRAGSMIGFF
FTNEPVINYETAKSSDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAA
EKVFAEISRR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagaagctatgaaaaatcaaaaacggcttttaaagaagcgcaaaaactcatgccgggc
ggtgtgaacagtcccgttcgcgcatttaaatcggtagacatggacccgatttttatggag
cgcggaaaaggctcgaaaatctttgatattgacgggaatgaatatattgactacgtcttg
tcatgggggcctttaattttagggcatacaaatgaccgcgtcgtagaaagcctcaaaaaa
gtggctgaatacgggacaagctttggtgctccgactgaagtagaaaatgaactggctaag
ctcgtcattgatcgtgtgccatctgtagaaattgtacgaatggtaagctccggaacagag
gctacaatgagtgccctccgtttggcaaggggctatacgggccgcaacaagattttaaaa
tttgagggctgctaccacggacacggcgattctctcttgattaaagctggttcaggtgtt
gccactctcggtctgcctgacagcccgggggtgcctgaaggcattgcgaaaaacaccatc
accgttccgtacaatgatttagaaagtgtaaagcttgctttccagcaattcggtgaagac
attgcgggagtcattgtagagccagttgccggaaatatgggtgttgttccgccgcaagaa
ggtttccttcagggtctgcgtgatatcactgagcagtacggctccctgctgatttttgat
gaagtgatgactggcttccgggtcgattataactgcgctcaaggctacttcggcgtaacg
cctgatctgacttgtttaggaaaagtaatcgggggcggacttcctgtcggcgcttatggc
ggaaaggcagaaatcatggagcagatcgctccaagcggtccgatctatcaagctggtaca
ttgtcaggcaacccgcttgcgatgacggctggcttagagacattgaaacagctgacacct
gaatcctacaagaatttcatcaaaaaaggcgacagactggaagaaggaatttcaaaaacc
gccggggctcatggcattccgcatacctttaaccgtgcaggttcgatgatcggtttcttc
tttacaaacgaaccagtcatcaattatgaaacagcgaaatcatctgatttgaagctgttc
gcaagctattataaagggatggcaaatgaaggggtattccttccgccatcacaattcgaa
ggtcttttcctctcaacggcccatactgatgaagatattgaaaacacaatccaggcagct
gagaaagtatttgctgagatcagccgcagataa

DBGET integrated database retrieval system