KEGG   Bacillus subtilis subsp. subtilis 168: BSU28130
Entry
BSU28130          CDS       T00010                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28130 (hemB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU28130 (hemB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BSU28130 (hemB)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU28130 (hemB)
SSDB
Motif
Pfam: ALAD YAcAr
Other DBs
NCBI-GeneID: 936972
NCBI-ProteinID: NP_390691
Pasteur: BG10344
BSORF: BG10344
UniProt: P30950 A0A6M3ZEN9
Position
complement(2874202..2875176)
AA seq 324 aa
MSQSFNRHRRLRTSKAMREMVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVHHVSLDL
LKDEVAELVKLGIQSVIVFGIPEEKDDCGTQAYHDHGIVQKAITEIKEHFPEMVVVADTC
LCEYTDHGHCGLVKDGVILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREALD
KEGFVNIPIMSYAVKYSSEFYGPFRDAANSTPQFGDRKTYQMDPANRMEALREAQSDVEE
GADFLIVKPSLSYMDIMRDVKNEFTLPLVAYNVSGEYSMVKAAAQNGWIKEKEIVLEILT
SMKRAGADLIITYHAKDAAKWLAE
NT seq 975 nt   +upstreamnt  +downstreamnt
atgagtcaatcatttaatagacaccgccgcctgcggacatcaaaagcaatgagagaaatg
gtaaaggaaacacgtttgcatccatcagattttatatatccgatttttgtcgttgaaggg
ctggaaggcaaaaaagctgttccgtcaatgcctgatgttcaccatgtatcattagattta
ttgaaggatgaagtagcggagctggtcaaactgggcattcaatctgttatcgtgttcggc
atcccggaagaaaaagatgattgcggaacacaagcgtaccatgatcacggaattgtccaa
aaagccatcacagaaattaaagaacacttccctgaaatggttgttgtcgctgacacgtgc
ctgtgcgaatatacagaccacggccattgcggacttgtcaaagacggagtcattctcaat
gatgaatcgctggagcttttggcgcagacagctgtcagccaagcgaaagcaggtgcggat
atcattgcgccatcaaacatgatggacggatttgttacagtgatcagagaagcacttgat
aaagaaggattcgtcaatattcccatcatgtcttacgctgttaaatattcaagtgagttt
tacggtccgttccgtgatgcagcaaacagcacaccgcaattcggagaccgcaaaacatat
cagatggaccctgccaaccgtatggaggcactccgcgaagcacaatcagatgttgaggaa
ggcgcggactttttgattgtcaaaccttcgctttcttatatggatatcatgcgtgacgta
aaaaatgagtttactttgccgctcgtcgcttataatgtaagcggagagtattcaatggtg
aaggctgcagcgcagaacggctggatcaaagaaaaagaaattgtgttggaaattttgaca
agcatgaagcgcgcgggtgccgacctgattattacgtatcatgcgaaagacgcagcgaaa
tggcttgcggagtaa

DBGET integrated database retrieval system