KEGG   Bacillus subtilis subsp. subtilis 168: BSU28140Help
Entry
BSU28140          CDS       T00010                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-iii synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28140 (hemD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSU28140 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 AAA_lid_10
Motif
Other DBs
NCBI-GeneID: 937287
NCBI-ProteinID: NP_390692
Pasteur: BG10343
BSORF: BG10343
UniProt: P21248
Position
complement(2875173..2875961)
Genome map
AA seq 262 aa AA seqDB search
MENDFPLKGKTVLVTRNKAQAASFQQKVEALGGKAVLTSLITFRRALPNDVAEQVREDLA
APGWLVFTSVNGADFFFSYLKENQLILPAHKKIAAVGEKTARRLKMHNVSVDVMPQEYIA
EQLADALKQHAEPGETITVMKGNLSRDVIKQELVPLGFEVKEWVLYETIPDEEGIEALKD
AAGQYSFDYVTFTSSSTVHTFMHVLGEELKKWKANGTACISIGPLTNDALLTYGITSHTP
DTFTIDGMLELMCSMSREEERI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgattttccgttgaaaggaaaaacagtgcttgtcacccggaataaggcacag
gcagcatcatttcagcaaaaagtggaggcgcttggcggtaaagcggttttaacctctttg
attacgtttcgccgcgctttgccgaatgatgttgcggaacaggtaagagaggatcttgcc
gcgccaggctggcttgtttttacaagtgtgaacggggcagacttctttttttcttatctg
aaggaaaatcagcttattctccctgcgcataaaaaaattgcagccgtcggtgaaaaaacc
gcgcgccgtttaaaaatgcataacgtatcggttgatgtgatgccacaggagtatattgct
gaacaattggctgacgctcttaagcagcatgctgaaccgggggagaccattaccgtgatg
aaagggaatttgtcacgtgatgtgataaaacaagagcttgtcccgctcggttttgaagta
aaggaatgggttctctacgaaacgattccggatgaagaaggcattgaggcattgaaagac
gctgcgggtcaatattcctttgactatgtaacatttacgagttcatcaaccgtacatacg
tttatgcatgtcttgggagaagaattaaaaaagtggaaggcgaatgggacggcctgtatc
agcattgggcctttaacaaatgatgcccttctgacgtacggcatcacatcgcatacgcct
gatacatttacaatagatggcatgcttgagttaatgtgcagcatgtcaagagaggaagag
agaatatga

DBGET integrated database retrieval system