KEGG   Bacillus subtilis subsp. subtilis 168: BSU28150
Entry
BSU28150          CDS       T00010                                 

Gene name
hemC
Definition
(RefSeq) porphobilinogen deaminase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28150 (hemC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     BSU28150 (hemC)
SSDB
Motif
Pfam: Porphobil_deam Porphobil_deamC
Other DBs
NCBI-GeneID: 937488
NCBI-ProteinID: NP_390693
Pasteur: BG10342
BSORF: BG10342
UniProt: P16616 A0A6M4JK18
Position
complement(2875951..2876895)
AA seq 314 aa
MMRTIKVGSRRSKLAMTQTKWVIQKLKEINPSFAFEIKEIVTKGDRIVDVTLSKVGGKGL
FVKEIEQALLNEEIDMAVHSMKDMPAVLPEGLVIGCIPEREDPRDALISKNRVKLSEMKK
GAVIGTSSLRRSAQLLIERPDLTIKWIRGNIDTRLQKLETEDYDAIILAAAGLSRMGWKQ
DVVTEFLEPERCLPAVGQGALAIECRESDEELLALFSQFTDEYTKRTVLAERAFLNAMEG
GCQVPIAGYSVLNGQDEIEMTGLVASPDGKIIFKETVTGNDPEEVGKRCAALMADKGAKD
LIDRVKRELDEDGK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgatgagaacgattaaagtaggttccagacggagcaaactcgctatgactcaaacaaaa
tgggttattcaaaaactgaaggaaatcaatccttcgtttgcttttgaaattaaagagatc
gtgacaaagggcgaccggattgtcgatgttacactctcaaaagtgggtggaaaagggctt
tttgtcaaagaaattgaacaggcgcttttaaacgaagagattgatatggcagtgcacagc
atgaaggacatgcctgctgttttgcctgaaggccttgtgatcggctgtattcctgaacgg
gaggacccgcgtgatgcccttatttcaaagaatcgcgtaaagctttcagaaatgaagaaa
ggtgctgtcattggcacaagcagtttaagaagaagcgcgcagcttttgattgagcgccct
gaccttacaattaaatggattagaggtaatatagatacaagacttcaaaagctggaaaca
gaggattatgacgcaattattttagcggctgccggcctttccagaatgggttggaagcaa
gatgtcgtaaccgaattccttgagcctgagcgctgtttgcctgctgtggggcagggagcc
ctggcgattgagtgccgagaatcggatgaagagctgttggcgttgttttctcagtttaca
gatgaatatacaaaacggactgtcttagcggaacgtgcttttttaaacgcgatggagggc
ggctgccaggttccgatcgcgggctactccgtgttaaatggacaggatgaaattgaaatg
acaggtcttgtcgcttcacctgacggcaaaatcatttttaaagaaaccgtcaccggaaac
gatccggaggaagtaggaaagcgctgtgccgctcttatggctgacaaaggagcaaaagat
ttaattgatcgtgtaaaacgggagcttgacgaggatggaaaatga

DBGET integrated database retrieval system