KEGG   Bacillus subtilis subsp. subtilis 168: BSU28160Help
Entry
BSU28160          CDS       T00010                                 

Gene name
hemX
Definition
(RefSeq) protein HemX
  KO
K02497  HemX protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BSU28160 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C_asm TMEM51
Motif
Other DBs
NCBI-GeneID: 937489
NCBI-ProteinID: NP_390694
Pasteur: BG10341
BSORF: BG10341
UniProt: P16645
Position
complement(2876928..2877758)
Genome map
AA seq 276 aa AA seqDB search
MIDTAMARLNEGTIVIYALSVLFYFIDFLQHNRKAGKMAFWLLSIVWTLQTVYLAYFMWV
TGRFPVLNVTEALYFYAWVLVTLSLVLTKLLRVDFIVFFTNVIGFSMIAIHTFSPTEQQS
AAFSGQLVSELLVIHITMAILSYGAFSLSFVFSVLYMFQYHLLKKKKWGKWLLRIEDLSK
LDYMAYVLNVIGVPMLLLSLILGVIWAYVSLETLYWFDAKVLGSFVVLLLYSYYLYIRLI
KELQGKVAALWNTACFLVLMINYFLLGSLSQFHWFS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattgatactgcaatggcaagacttaatgaggggacaatcgtcatttacgcgttaagt
gtactcttttattttatagattttcttcaacacaaccggaaggctggaaaaatggccttc
tggttgctttctattgtctggactctgcaaaccgtgtatttggcctattttatgtgggtg
acggggcggtttccggtattaaatgtgacagaggcactttatttttatgcctgggtgctt
gtcacgctgtcacttgtactgacaaagcttttacgtgttgactttatcgtgttttttaca
aatgttataggattttctatgatcgccattcacacattttcaccgacagagcagcagtca
gctgctttttccgggcagcttgtatccgagcttttggtgattcatattacaatggcgatt
ctttcatacggcgctttttccctttctttcgttttttctgtgctatatatgtttcaatat
catctgctgaaaaagaaaaagtggggaaaatggctgttgagaatagaagatttatctaag
cttgattatatggcgtatgttttaaatgtcattggggttccgatgctgctgctgagtttg
attctcggcgtcatttgggcgtatgtctcactagaaacgctgtattggtttgacgccaaa
gtgcttggttcgtttgtcgtcctgctgctgtacagctattatctttatatcaggctgatt
aaggagctgcaaggaaaggtcgctgcactgtggaatacggcttgttttctggtgctgatg
atcaattatttcctgcttggaagcctgtcgcaattccattggttcagttaa

DBGET integrated database retrieval system