KEGG   Bacillus subtilis subsp. subtilis 168: BSU28170
Entry
BSU28170          CDS       T00010                                 

Gene name
hemA
Definition
(RefSeq) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU28170 (hemA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     BSU28170 (hemA)
SSDB
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer 2-Hacid_dh_C NAD_binding_2 F420_oxidored OCD_Mu_crystall ThiF TrkA_N AdoHcyase_NAD Sacchrp_dh_NADP NAD_binding_7 NAD_binding_10 ApbA IlvN Latarcin THF_DHG_CYH_C DUF1593 MutS_III TfuA
Other DBs
NCBI-GeneID: 937443
NCBI-ProteinID: NP_390695
Pasteur: BG10340
BSORF: BG10340
UniProt: P16618 A0A6M3ZEU1
Position
complement(2877766..2879133)
AA seq 455 aa
MHILVVGVDYKSAPIEIREKVSFQPNELAEAMVQLKEEKSILENIIVSTCNRTEIYAVVD
QLHTGRYYIKKFLADWFQLSKEELSPFLTFYESDAAVEHLFRVACGLDSMVIGETQILGQ
VRDSFKTAQQEKTIGTIFNELFKQAVTVGKRTHAETDIGSNAVSVSYAAVELAKKIFGNL
SSKHILILGAGKMGELAAENLHGQGIGKVTVINRTYLKAKELADRFSGEARSLNQLESAL
AEADILISSTGASEFVVSKEMMENANKLRKGRPLFMVDIAVPRDLDPALNDLEGVFLYDI
DDLEGIVEANMKERRETAEKVELLIEETIVEFKQWMNTLGVVPVISALREKALAIQSETM
DSIERKLPHLSTREKKLLNKHTKSIINQMLRDPILKVKELAADADSEEKLALFMQIFDIE
EAAGRQMMKTVESSQKVHSFKKAESKAGFSPLVSE
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgcatatacttgttgtgggagtagattataaatccgcccctattgagatacgtgaaaaa
gtaagttttcagccgaatgagctggcagaagcaatggtgcagctgaaagaagagaaaagc
attcttgaaaacatcattgtctcaacctgcaaccgcactgaaatttatgcggtagtcgac
cagcttcataccggccgttattatataaaaaagtttttagctgattggtttcaattaagc
aaagaagagctgtcaccgttcttaacgttttatgagagcgatgccgctgttgagcattta
ttccgtgtagcctgcggacttgattctatggtgattggcgaaacgcagattctcggacag
gtacgcgacagctttaaaacagctcagcaagaaaaaacgatcgggactatttttaatgag
ctgtttaagcaggcagttacagtgggcaaacggactcacgccgaaacagacattggctca
aatgcggtgtcagtaagctatgctgcagttgaacttgccaaaaaaatcttcggaaatctt
tcaagcaagcacatattgattctcggtgcgggaaaaatgggcgagcttgctgcggaaaac
ctgcacggacagggaatcggcaaggtcactgtcattaaccgaacatacttgaaagcgaag
gagcttgcagaccgtttttcaggtgaagcgagaagcttgaatcagcttgaaagcgcgctt
gcggaggctgatattttaatcagttcaaccggtgcaagtgaatttgtcgtgtccaaagag
atgatggaaaacgcgaataagcttcgcaagggacgtccgctgtttatggtcgacattgcc
gtgcctagagatcttgatccggcgctgaatgatcttgaaggtgtttttctttatgatatc
gacgatctggaaggcattgtagaagcgaacatgaaagagcggagagaaacagctgaaaaa
gttgaactgttaattgaagaaaccattgtggaatttaaacaatggatgaatacacttggt
gttgtgcctgttatttctgcattgcgcgaaaaggcgcttgccatccagtcagaaacgatg
gacagcattgagcgtaagctgcctcacttaagcacaagagagaaaaaactgttgaacaaa
cacaccaaaagtattattaaccaaatgcttcgtgatccgattttaaaggtgaaagagctt
gcggcagatgctgattctgaagaaaagctcgcgttgtttatgcagatttttgatattgaa
gaagctgcgggccgtcaaatgatgaaaaccgttgaaagcagccagaaggtccactctttt
aagaaggctgaatcaaaagcgggctttagcccacttgtaagtgagtga

DBGET integrated database retrieval system