KEGG   Bacillus subtilis subsp. subtilis 168: BSU28180
Entry
BSU28180          CDS       T00010                                 

Gene name
ysxD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5668 DUF2157
Other DBs
NCBI-GeneID: 937352
NCBI-ProteinID: NP_390696
Pasteur: BG11068
BSORF: BG11068
UniProt: P40736 A0A6M3ZEU0
Position
2879363..2879860
AA seq 165 aa
MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF
IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL
YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaacaaaaatcaattttattcccttgtctgctgcttgccgcttctgtatatgcatgg
ctagaaagcggccaagccgaactgttttcagggcaggatcaatggcctgttctcctcatg
ctgttaggcgcagcctttgtatatcaaggaaaaaaagaagccgtcacaccccattttttt
atcggtttgcttctcttcgggatcggtttacacttttttgccaagccgaaatgggtatgg
tggccggatgattttgaaatgctcctctttatgatcggcttctcacttctcgtttcaacc
gttcaaaaaaaagaatatgtatatgaagctgtgtcgatgatttgtttttccctgtttttg
tactttttcaaacaaattatggcatggcttgagtctgcgcatattccaacagcgcttctg
aaggagtattggccgtttgtctttattggaatcagtttattgttattattgataaaacga
aaaaaatctatacgataa

DBGET integrated database retrieval system