KEGG   Bacillus subtilis subsp. subtilis 168: BSU28180Help
Entry
BSU28180          CDS       T00010                                 

Gene name
ysxD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2157
Motif
Other DBs
NCBI-GeneID: 937352
NCBI-ProteinID: NP_390696
Pasteur: BG11068
BSORF: BG11068
UniProt: P40736
Position
2879363..2879860
Genome map
AA seq 165 aa AA seqDB search
MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF
IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL
YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaatcaattttattcccttgtctgctgcttgccgcttctgtatatgcatgg
ctagaaagcggccaagccgaactgttttcagggcaggatcaatggcctgttctcctcatg
ctgttaggcgcagcctttgtatatcaaggaaaaaaagaagccgtcacaccccattttttt
atcggtttgcttctcttcgggatcggtttacacttttttgccaagccgaaatgggtatgg
tggccggatgattttgaaatgctcctctttatgatcggcttctcacttctcgtttcaacc
gttcaaaaaaaagaatatgtatatgaagctgtgtcgatgatttgtttttccctgtttttg
tactttttcaaacaaattatggcatggcttgagtctgcgcatattccaacagcgcttctg
aaggagtattggccgtttgtctttattggaatcagtttattgttattattgataaaacga
aaaaaatctatacgataa

DBGET integrated database retrieval system