KEGG   Bacillus subtilis subsp. subtilis 168: BSU28210Help
Entry
BSU28210          CDS       T00010                                 

Gene name
lonB
Definition
(RefSeq) Lon protease 2
  KO
K04076  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU28210 (lonB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     BSU28210 (lonB)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S16: lon protease family
   BSU28210 (lonB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C AAA Mg_chelatase ChlI Sigma54_activat RuvB_N AAA_5 AAA_22 AAA_16 AAA_32 AAA_2 AAA_30 ATPase_2 NACHT AAA_19 AAA_24 NTPase_1 MCM TIP49_C NB-ARC RNA_helicase AAA_18 OpcA AAA_33 AAA_7
Motif
Other DBs
NCBI-GeneID: 937484
NCBI-ProteinID: NP_390699
Pasteur: BG11077
BSORF: BG11077
UniProt: P42425
Position
complement(2882971..2884629)
Genome map
AA seq 552 aa AA seqDB search
MSWTGIALFIQLFFGIIIGLYFWNLLKNQRTQKVTIDKESKKEMEQLRKMRAISLSEPLS
EKVRPKSFKDIVGQEDGIKALKAALCGPNPQHVIVYGPPGVGKTAAARLVLEEAKKHKQS
PFKEQAVFVELDATTARFDERGIADPLIGSVHDPIYQGAGAMGQAGIPQPKQGAVTHAHG
GVLFIDEIGELHPIQMNKMLKVLEDRKVFLDSAYYSEENTQIPNHIHDIFQNGLPADFRL
IGATTRMPNEIPPAIRSRCLEVFFRELEKDELKTVAKTAADKIEKNISEEGLDLLTSYTR
NGREAVNMIQIAAGMAVTENRKDITIEDIEWVIHSSQLTPKHEQKIGVEPQVGIVNGLAV
YGPNSGSLLEIEVSVTAAQDKGSINITGIAEEESIGSQSKSIRRKSMAKGSVENVLTVLR
TMGMKPSDYDIHINFPGGIPIDGPSAGIAMAAGIFSAIHKIPIDNTVAMTGEISLNGLVK
PIGGVIPKIKAAKQSGAKKVIIPYENQQAILKQIDGIEIIAVKTFQEVLDEILVNPPTEQ
KPFHIEINKESV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagttggacagggatcgcgttatttattcagctgttttttgggatcatcatcggtttg
tatttttggaatttgcttaaaaatcaaaggacacaaaaggtcacgatagataaagaatca
aagaaggaaatggagcagcttcggaaaatgcgcgctatcagcttgtccgagccattatct
gagaaggtccgccccaaaagctttaaagatatcgtcggacaggaagacggcattaaagca
ttaaaggcggctttatgcgggccaaatcctcagcatgtgattgtctatgggccaccggga
gttgggaaaacggctgctgcgcggcttgtgttggaagaagcaaaaaaacataaacaatca
ccgtttaaagagcaggctgtctttgtggaactcgatgcgacaacagcccgttttgatgaa
agaggaattgccgatccgctcatcggctctgtccatgacccgatataccaaggggccgga
gcgatgggacaggctgggattccgcagccgaagcagggagctgtcacccatgcccatggc
ggtgtgctgtttattgatgaaataggggagctgcatcctattcaaatgaataaaatgctg
aaggtgcttgaggacagaaaagtctttttagacagtgcgtattacagtgaggaaaataca
caaattccgaatcatattcatgatatttttcaaaatgggctgccggctgattttcgcttg
attggcgcgaccacgagaatgccaaacgaaattccgccagctatccggtcccgctgtttg
gaggtttttttccgcgagcttgaaaaggacgagctgaaaacggttgccaaaacagcagcg
gataaaattgaaaaaaatatctccgaagaaggactggatcttttgaccagctacacgcgg
aacgggcgggaagccgtcaatatgattcaaatcgcagcggggatggctgtaacggagaat
cgaaaggacattacgattgaggatattgaatgggtcattcactccagtcagcttactcca
aagcacgagcaaaaaatcggtgttgaaccacaggttggcattgtaaatgggcttgcagtc
tatgggcctaacagcggatcgcttctggaaatcgaagtaagtgtaaccgcggctcaagat
aaaggatcaattaacatcacaggaatagctgaagaagaaagcatcggcagccaatcaaaa
tcgatcaggcgaaaaagcatggcgaagggttcggttgaaaatgtattaaccgtgctccgg
acaatgggaatgaagccttctgattatgatattcacatcaatttcccaggagggattccg
attgatgggccgtcagcaggcattgcgatggcggcggggattttctcggcgatacacaaa
attcctattgacaataccgttgcgatgacgggcgaaatcagcctgaacggtcttgtgaaa
cccatcggaggcgtcattccgaaaataaaagcggccaagcagtccggtgcgaaaaaggtg
attatcccatatgaaaatcagcaggccatcttaaagcagattgacgggatcgagattatt
gcagtgaagacgttccaagaagtgcttgatgaaattttggtgaatccgccaacggaacaa
aaaccgtttcatatcgaaatcaataaagaatccgtttaa

DBGET integrated database retrieval system