KEGG   Bacillus subtilis subsp. subtilis 168: BSU28230Help
Entry
BSU28230          CDS       T00010                                 

Gene name
tig
Definition
(RefSeq) trigger factor
  KO
K03545  trigger factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU28230 (tig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_C Trigger_N FKBP_C SurA_N_3 TerB_N SurA_N
Motif
Other DBs
NCBI-GeneID: 936610
NCBI-ProteinID: NP_390701
Pasteur: BG19023
BSORF: BG19023
UniProt: P80698
Position
complement(2886315..2887589)
Genome map
AA seq 424 aa AA seqDB search
MSVKWEKQEGNEGVLTVEVDAETFKTALDDAFKKVVKQVSIPGFRKGKIPRGLFEQRFGV
EALYQDALDILLPVEYPKAVEEAGIEPVDRPEIDVEKIEKGESLIFTAKVTVKPEVKLGE
YKGLGIEKDDTTVTDEDVQNELKALQERQAELVVKEEGAVEEGNTVVLDFEGFVDGEAFE
GGKAENYSLEVGSGSFIPGFEDQLVGLEAGAEKDVEVTFPEEYHAEDLAGKPAVFKVKIH
EIKAKELPELDDEFAKDIDEEVETLAELTEKTKKRLEEAKENEADAKLREELVLKASENA
EIDVPQAMVDTELDRMLKEFEQRLQMQGMNLELYTQFSGQDEAALKEQMKEDAEKRVKSN
LTLEAIAKAENLEVSDEEVDAELTKMAEAYNMPVENIKQAIGSTDAMKEDLKVRKAIDFL
VENR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaatgggaaaaacaagaaggcaacgaaggcgttttaacggttgaagttgat
gctgaaacgtttaaaacagcacttgatgatgcatttaaaaaagtagtaaaacaagtttca
attcctggattccgtaaaggtaaaattcctcgcggattattcgaacagcgctttggcgta
gaagctctttaccaagatgctttggatattcttcttcctgtagaataccctaaagcggtt
gaagaagctggaatcgagcctgtagaccgtcctgaaatcgatgttgaaaaaatcgaaaaa
ggcgaaagcttaatcttcactgcgaaagtaacagtaaaacctgaagtgaagcttggcgaa
tacaaaggcctgggcattgaaaaagacgacacaactgtaactgacgaagatgttcaaaac
gaactaaaagcccttcaagagcgtcaagctgagcttgttgtaaaagaagaaggcgccgtt
gaagaaggaaacacagttgttcttgatttcgaaggattcgttgacggcgaagctttcgaa
ggcggaaaagctgaaaactactctctagaagtaggttctggttcattcatccctggcttc
gaagatcaattagttggccttgaagcaggtgctgagaaggatgttgaagtgacattccct
gaggagtaccacgctgaagatcttgcaggcaaaccagctgtgtttaaagtgaaaattcac
gaaatcaaagcgaaagagcttcctgagcttgacgatgaattcgcaaaagatatcgatgaa
gaagtggaaacacttgctgaattaactgaaaaaacaaagaaacgtttagaagaagcaaaa
gaaaacgaagctgacgctaaattgcgtgaagagcttgttctgaaagcttctgaaaatgct
gaaatcgatgtgcctcaagcaatggtcgacactgagcttgaccgcatgctgaaagaattc
gaacagcgtctgcaaatgcaaggcatgaaccttgagctttacactcaattctcaggccaa
gatgaagctgcgcttaaagagcaaatgaaagaagatgctgaaaaacgcgtaaaatctaac
ctgactcttgaggcgattgcgaaagcggaaaaccttgaagtatcagatgaggaagttgat
gctgagcttacaaaaatggctgaagcatacaacatgcctgttgaaaatattaaacaagcc
atcggttctactgacgcgatgaaagaagatttaaaagttcgcaaagcaattgattttctt
gtagaaaaccgttaa

DBGET integrated database retrieval system