KEGG   Bacillus subtilis subsp. subtilis 168: BSU28240Help
Entry
BSU28240          CDS       T00010                                 

Gene name
ysoA
Definition
(RefSeq) TPR repeat-containing protein YsoA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_19 TPR_2 TPR_1 ANAPC3 TPR_16 Coatomer_E SPO22 TPR_7 TPR_12 SPOB_a MIT YcaO_C SRP_TPR_like PPR TPR_3
Motif
Other DBs
NCBI-GeneID: 937479
NCBI-ProteinID: NP_390702
Pasteur: BG12338
BSORF: BG12338
UniProt: P94569
Position
complement(2887817..2888821)
Genome map
AA seq 334 aa AA seqDB search
MTHDKKNAKIIPFPHLKDRLVEKGMSSLKEKKYQEALELFSEAMKYDDTESDLHLGMAIC
FLELGELEEAESVCEKMLKEGYGHYFTVLQVYMTILIQLKKYEEVKSTIEAVLEENQLPA
ESAEQFYKLLDFSRKMTDPDREDEAWAEEYEDTIDTEKVLASPEEQMNLIHSLKDRNVAK
YTGLLKTILQDPSAHPIIKTMIVMLLAEHEYSKPVHISKFGESLTIEPSEIVPPDAAPIL
HRVLRVLDETLGNENPTLYAAVEELWRRHLYVLYPFQPKLLSADLWAAALHKVGYEMHGI
EIESEELHMMYEFTDRELDEACTMLKDIEEISYL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatgacaagaaaaacgcaaaaattattccttttcctcatctgaaagaccgcctt
gtggaaaaagggatgtcatcactcaaggaaaaaaagtatcaagaagcgcttgaactgttt
tcagaagcgatgaaatatgatgatactgaatccgatcttcacttagggatggccatctgc
tttttagagctgggcgagctggaagaggcagaaagcgtgtgcgagaagatgctcaaagaa
ggttatggccattattttacggttttgcaggtgtacatgaccatcttaattcagctcaaa
aagtacgaagaagtcaaaagcaccattgaagccgttttggaagaaaatcagctgccggca
gaaagtgccgagcaattttataagctgctggatttcagccggaaaatgaccgatccggat
cgtgaggacgaggcttgggccgaagaatatgaggatacaattgacaccgagaaagtgctg
gcaagccctgaggagcaaatgaatctcattcattccttaaaagaccgtaacgtagcaaag
tatacaggattgctcaaaacaatcctccaagacccctcagcccatccgattatcaaaacg
atgattgtcatgctgttggctgagcatgagtacagtaaacctgtacacattagtaaattt
ggcgagtcgttgacaattgaaccgtcagagattgttccgcctgatgccgcgccgattctt
caccgtgttctcagggtgctagatgagacacttggaaatgaaaatccaaccttatatgca
gcagtagaagaattgtggagaagacatttgtacgttttatatccgttccagccgaaattg
ctgtcggctgacctttgggcggctgcccttcataaagtcggttacgagatgcacgggatt
gaaattgaaagcgaagaacttcatatgatgtatgaatttacagacagagaactcgatgaa
gcttgcacaatgttaaaagatattgaagaaatttcttatttgtaa

DBGET integrated database retrieval system