KEGG   Bacillus subtilis subsp. subtilis 168: BSU28260Help
Entry
BSU28260          CDS       T00010                                 

Gene name
leuC
Definition
(RefSeq) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00660  C5-Branched dibasic acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    BSU28260 (leuC)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28260 (leuC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     BSU28260 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     BSU28260 (leuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-GeneID: 937478
NCBI-ProteinID: NP_390704
Pasteur: BG11949
BSORF: BG11949
UniProt: P80858
Position
complement(2889552..2890970)
Genome map
AA seq 472 aa AA seqDB search
MMPRTIIEKIWDQHIVKHGEGKPDLLYIDLHLIHEVTSPQAFEGLRQKGRKVRRPQNTFA
TMDHNIPTVNRFEIKDEVAKRQVTALERNCEEFGVRLADLHSVDQGIVHVVGPELGLTLP
GKTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLSTQTLWQQRPKTLEVRVDGTLQKGVTA
KDVILAVIGKYGVKFGTGYVIEYTGEVFRNMTMDERMTVCNMSIEAGARAGLIAPDEVTF
EYCKNRKYTPKGEEFDKAVEEWKALRTDPGAVYDKSIVLDGNKISPMVTWGINPGMVLPV
DSEVPAPESFSAEDDKKEAIRAYEYMGLTPHQKIEDIKVEHVFIGSCTNSRMTDLRQAAD
MIKGKKVADSVRAIVVPGSQSVKLQAEKEGLDQIFLEAGFEWRESGCSMCLSMNNDVVPE
GERCASTSNRNFEGRQGKGARTHLVSPAMAAMAAIHGHFVDVRKFYQEKTVV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctcgaacaatcatcgaaaagatttgggatcagcatattgtaaaacatggtgag
ggaaagccggatcttctctatattgatttgcacctcattcatgaggtgacgtctcctcag
gcatttgaaggcttgagacaaaagggaagaaaggtcagaagaccccaaaacacatttgcg
acaatggaccacaacatcccgactgtcaatcgttttgagataaaggatgaagttgcgaaa
cgccaggtaacggcgcttgaaagaaactgtgaggaatttggcgtgcgccttgccgatctt
cacagtgtggatcaagggattgtccatgtcgtcggacctgaactaggcttaacgcttcca
gggaaaacgattgtgtgcggtgacagtcatacatcaacacatggcgctttcggcgctctt
gcatttggaatcgggacgagtgaagttgaacatgtcctttccacacagacactttggcag
cagcgtccaaaaacacttgaagtgcgcgtagatggaacgcttcaaaaaggggtaacggca
aaggatgtcatccttgctgtcatcggcaaatacggtgtgaaattcggcacaggctacgtc
attgaatacactggggaagtattcagaaatatgacgatggatgaacgaatgactgtttgt
aacatgtcaattgaagcaggagcaagagcaggtttgattgcacctgacgaggtgacgttt
gaatattgcaaaaatcgcaagtacacgccaaaaggcgaagaatttgacaaggccgtagag
gaatggaaggcgctgcgcacagacccgggcgctgtttacgataaatctatcgtccttgac
ggcaacaaaatttcccctatggtgacatggggcattaacccgggaatggttcttcctgtc
gattctgaagttcctgcgccggaaagcttttctgcagaagacgataaaaaagaagcgatt
cgtgcttatgaatatatgggattgactcctcaccaaaaaattgaagacattaaagtggag
cacgtatttatcggttcctgcacaaattcccgcatgactgaccttcgacaggctgctgac
atgatcaaagggaagaaggtagctgacagcgtaagggccatcgtcgtgcccggatcccaa
agcgtgaagcttcaggctgaaaaagaagggcttgaccagattttcttggaagctggattt
gaatggagagagtcaggctgcagcatgtgtttgagtatgaataatgatgttgttcctgag
ggagagcgctgtgcatcaacctctaaccgcaacttcgagggcagacaaggaaaaggtgca
agaacacatctcgtcagcccggcaatggctgcgatggctgccattcacggacacttcgtt
gatgtcagaaagttttatcaggaaaaaacagttgtgtaa

DBGET integrated database retrieval system