KEGG   Bacillus subtilis subsp. subtilis 168: BSU28270Help
Entry
BSU28270          CDS       T00010                                 

Gene name
leuB
Definition
(RefSeq) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00660  C5-Branched dibasic acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    BSU28270 (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28270 (leuB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     BSU28270 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 936221
NCBI-ProteinID: NP_390705
Pasteur: BG10675
BSORF: BG10675
UniProt: P05645
Position
complement(2891020..2892117)
Genome map
AA seq 365 aa AA seqDB search
MKKRIALLPGDGIGPEVLESATDVLKSVAERFNHEFEFEYGLIGGAAIDEHHNPLPEETV
AACKNADAILLGAVGGPKWDQNPSELRPEKGLLSIRKQLDLFANLRPVKVFESLSDASPL
KKEYIDNVDFVIVRELTGGLYFGQPSKRYVNTEGEQEAVDTLFYKRTEIERVIREGFKMA
AARKGKVTSVDKANVLESSRLWREVAEDVAQEFPDVKLEHMLVDNAAMQLIYAPNQFDVV
VTENMFGDILSDEASMLTGSLGMLPSASLSSSGLHLFEPVHGSAPDIAGKGMANPFAAIL
SAAMLLRTSFGLEEEAKAVEDAVNKVLASGKRTRDLARSEEFSSTQAITEEVKAAIMSEN
TISNV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaacgtattgctctattgcccggagacgggatcggccctgaagtattagaatca
gcgacagacgtactgaaaagtgttgccgaacgctttaaccatgaatttgaatttgaatat
ggcctgattggaggggcggctattgatgaacatcataaccccctcccggaggaaaccgtt
gctgcttgtaaaaatgcagacgcgatattgcttggtgctgtcggcggaccgaaatgggat
caaaatccttcggaactgagaccggaaaaagggctgctcagcatcagaaaacagcttgat
ttgtttgcgaatttgcggcctgtgaaggtatttgaaagcctttctgacgcttcgcctttg
aaaaaagaatatatagataatgttgatttcgttatcgttcgtgagctcacaggcggcttg
tatttcggccagccgagcaaacgttatgtaaacactgaaggtgagcaggaagcagtagat
acactgttttataagcgaacggaaattgaacgagtgatcagagagggcttcaaaatggcg
gcagccagaaaaggcaaagtgacctctgtagataaagcgaatgttcttgaatcaagccgg
ctgtggcgtgaagtggctgaggacgttgcacaagaatttcctgatgtgaagcttgagcac
atgcttgtggataacgcggccatgcagctaatttatgcaccgaatcaatttgatgtcgtg
gtgactgaaaatatgttcggtgatattttaagcgatgaagcgtccatgcttacaggctcg
ctcggaatgctcccgtcagccagcctatcaagctctggccttcatctgtttgaacctgtt
catggctccgcgcctgatattgccggtaaagggatggcaaatccgttcgcagccatattg
tcagcggcaatgcttttgagaacatctttcgggcttgaagaggaagcgaaagctgtagaa
gatgcggtaaacaaagtcttggcttctggaaaaagaacaagagacttggcacggagtgaa
gagttcagcagcactcaggccattacagaggaagttaaggcagcaatcatgagtgaaaat
acaatttctaatgtgtga

DBGET integrated database retrieval system