KEGG   Bacillus subtilis subsp. subtilis 168: BSU28280Help
Entry
BSU28280          CDS       T00010                                 

Gene name
leuA
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU28280 (leuA)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28280 (leuA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     BSU28280 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer Retrotran_gag_2
Motif
Other DBs
NCBI-GeneID: 936316
NCBI-ProteinID: NP_390706
Pasteur: BG11948
BSORF: BG11948
UniProt: P94565
Position
complement(2892138..2893694)
Genome map
AA seq 518 aa AA seqDB search
MRKINFFDTTLRDGEQSPGVNLNTQEKLAIAKQLERLGADIIEAGFPASSRGDFLAVQEI
ARTIKNCSVTGLARCVKGDIDAAWEALKDGAQPRIHVFIATSDIHLKHKLKMTREQVIER
AVGMVKYAKERFPIVQWSAEDACRTELPFLAEIVEKVIDAGASVINLPDTVGYLAPAEYG
NIFKYMKENVPNIHKAKLSAHCHDDLGMAVANSLAAIENGADQIECAVNGIGERAGNAAL
EEIAVALHTRKDFYQVETGITLNEIKRTSDLVSKLTGMAVPRNKAVVGDNAFAHESGIHQ
DGFLKEKSTYEIISPELVGVTADALVLGKHSGRHAFKDRLTALGFQFDSEEINKFFTMFK
ELTEKKKEITDEDLVSLILEEKVTDRKIGYEFLSLQVHYGTSQVPTATLSLKNQENAQLI
QEAATGAGSVEAIYNTLERCIDKDVELLDYRIQSNRKGEDAFAQVYVRVLVNGKESAGRG
IAQDVLEASAKAYLNAVNRQLVFQSNMSGLKNHTAVGS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaaattaattttttcgatacgacgcttcgtgatggtgaacagtcccctggagtg
aacttgaatacacaggagaaacttgccatagctaagcagctcgaaagactcggggcagac
atcattgaagcgggatttcccgcttcgtcccgaggtgactttttagctgttcaggaaatc
gcaagaaccattaaaaattgttcagtaactggtctggcccgttgtgtaaaaggtgatatt
gatgctgcttgggaagcgttaaaggatggcgctcaaccaagaattcatgtatttatcgcg
acatcggacattcatttgaagcacaagctgaaaatgacacgtgaacaagtcattgaaaga
gcagttggaatggtgaaatacgcaaaagaacgttttccgattgtgcaatggtcagctgaa
gatgcctgccgcactgaactgccgtttctagcagaaatcgtcgagaaagtgattgacgca
ggcgccagtgttatcaatcttccggacactgtcggctacctggccccggcggaatacgga
aatatctttaaatatatgaaagaaaacgttccgaacattcacaaagcaaagctttcagcc
cactgtcatgatgatttgggaatggcagtcgcaaactctcttgctgcgattgaaaatggc
gctgatcaaatcgaatgcgctgtgaacgggatcggtgaaagagccggaaacgcggcatta
gaggaaattgccgtagccctccataccagaaaagatttctaccaagtcgaaacaggtatt
acgctgaacgagattaagagaacaagtgatttagtaagcaaactgacaggcatggctgtc
ccgcgcaacaaagcggttgttggagataatgcatttgctcatgaatcaggcatccatcag
gacggctttttaaaggaaaaatcgacttatgaaattatttcaccggagcttgtcggcgta
accgcagatgcgcttgtcctaggtaaacattccggacgccacgcatttaaagaccggctg
actgctttaggattccaatttgacagtgaagagattaataaattctttacgatgttcaaa
gagttgactgagaagaaaaaagaaatcactgatgaggatcttgtttctcttattttagaa
gaaaaagtaacagatcgcaagattgggtatgaatttctttctctgcaagtacattacgga
acaagtcaggtccctacggctactctatctttgaaaaatcaagaaaacgcacagcttatt
caggaagctgcaactggagctggaagcgtggaagcaatctacaatacgcttgagcgctgc
atcgataaggatgtggagctcttagactaccgcattcagtctaatagaaaaggcgaagat
gcatttgcccaggtgtatgtaagagttttggtgaacggaaaagaatcagcagggcggggc
atagcgcaagacgtattagaagcatcagcgaaagcctatttgaacgcagtaaaccgtcaa
ttggttttccagtcgaatatgagcggattgaaaaaccacacagctgtcggatcataa

DBGET integrated database retrieval system