KEGG   Bacillus subtilis subsp. subtilis 168: BSU28290
Entry
BSU28290          CDS       T00010                                 

Symbol
ilvC
Name
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28290 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU28290 (ilvC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     BSU28290 (ilvC)
SSDB
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C F420_oxidored NAD_binding_2 AdoHcyase_NAD CoA_binding ApbA DUF5806 NAD_Gly3P_dh_N NAD_binding_7 Oxidored_nitro GARS_N
Other DBs
NCBI-GeneID: 937475
NCBI-ProteinID: NP_390707
Pasteur: BG10672
BSORF: BG10672
UniProt: P37253 A0A6M3ZI24
Position
complement(2893681..2894709)
AA seq 342 aa
MVKVYYNGDIKENVLAGKTVAVIGYGSQGHAHALNLKESGVDVIVGVRQGKSFTQAQEDG
HKVFSVKEAAAQAEIIMVLLPDEQQQKVYEAEIKDELTAGKSLVFAHGFNVHFHQIVPPA
DVDVFLVAPKGPGHLVRRTYEQGAGVPALFAIYQDVTGEARDKALAYAKGIGGARAGVLE
TTFKEETETDLFGEQAVLCGGLSALVKAGFETLTEAGYQPELAYFECLHELKLIVDLMYE
EGLAGMRYSISDTAQWGDFVSGPRVVDAKVKESMKEVLKDIQNGTFAKEWIVENQVNRPR
FNAINASENEHQIEVVGRKLREMMPFVKQGKKKEAVVSVAQN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggtaaaagtatattataacggtgatatcaaagagaacgtattggctggaaaaacagta
gcggttatcgggtacggttcgcaaggccacgcacatgccctgaaccttaaagaaagcgga
gtagacgtgatcgtcggtgttagacaaggaaaatctttcactcaagcccaagaagacgga
cataaagtattttcagtaaaagaagcggcagcccaagccgaaatcatcatggttctgctt
ccggatgagcagcagcaaaaagtatacgaagctgaaatcaaagatgaattgacagcagga
aaatcattagtattcgctcatggatttaacgtgcatttccatcaaattgttcctccggcg
gatgtagatgtattcttagtggcccctaaaggcccgggacacttggtaagaagaacatat
gagcaaggagctggcgtacctgcattgttcgcaatctatcaagatgtgactggagaagca
agagacaaagccctcgcttatgctaaaggaatcggcggcgcaagagcgggcgtattagaa
acgacatttaaagaagaaacagaaacagatttgttcggtgagcaagcagttctttgcggc
ggattaagcgcgcttgtcaaagccggatttgaaaccttaactgaagcaggttatcagcct
gaacttgcatacttcgagtgtcttcatgagctgaaattaatcgtagaccttatgtacgaa
gaaggacttgcaggaatgagatattcaatctctgacacagcacagtggggagatttcgta
tcaggccctcgcgttgtggacgccaaagtaaaagaatctatgaaagaagtattaaaagat
atccaaaacggtacattcgcaaaagagtggatcgtcgaaaaccaagtaaaccgtcctcgt
ttcaacgctatcaatgcaagcgagaacgaacatcaaatcgaagtagtgggaagaaagctt
cgtgaaatgatgccgtttgtgaaacaaggcaagaagaaggaagcggtggtctccgttgcg
caaaattaa

DBGET integrated database retrieval system