KEGG   Bacillus subtilis subsp. subtilis 168: BSU28290Help
Entry
BSU28290          CDS       T00010                                 

Gene name
ilvC
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28290 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU28290 (ilvC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     BSU28290 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C F420_oxidored NAD_binding_2 AdoHcyase_NAD CoA_binding ApbA GARS_N NAD_Gly3P_dh_N NAD_binding_7 Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 937475
NCBI-ProteinID: NP_390707
Pasteur: BG10672
BSORF: BG10672
UniProt: P37253
Position
complement(2893681..2894709)
Genome map
AA seq 342 aa AA seqDB search
MVKVYYNGDIKENVLAGKTVAVIGYGSQGHAHALNLKESGVDVIVGVRQGKSFTQAQEDG
HKVFSVKEAAAQAEIIMVLLPDEQQQKVYEAEIKDELTAGKSLVFAHGFNVHFHQIVPPA
DVDVFLVAPKGPGHLVRRTYEQGAGVPALFAIYQDVTGEARDKALAYAKGIGGARAGVLE
TTFKEETETDLFGEQAVLCGGLSALVKAGFETLTEAGYQPELAYFECLHELKLIVDLMYE
EGLAGMRYSISDTAQWGDFVSGPRVVDAKVKESMKEVLKDIQNGTFAKEWIVENQVNRPR
FNAINASENEHQIEVVGRKLREMMPFVKQGKKKEAVVSVAQN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagtatattataacggtgatatcaaagagaacgtattggctggaaaaacagta
gcggttatcgggtacggttcgcaaggccacgcacatgccctgaaccttaaagaaagcgga
gtagacgtgatcgtcggtgttagacaaggaaaatctttcactcaagcccaagaagacgga
cataaagtattttcagtaaaagaagcggcagcccaagccgaaatcatcatggttctgctt
ccggatgagcagcagcaaaaagtatacgaagctgaaatcaaagatgaattgacagcagga
aaatcattagtattcgctcatggatttaacgtgcatttccatcaaattgttcctccggcg
gatgtagatgtattcttagtggcccctaaaggcccgggacacttggtaagaagaacatat
gagcaaggagctggcgtacctgcattgttcgcaatctatcaagatgtgactggagaagca
agagacaaagccctcgcttatgctaaaggaatcggcggcgcaagagcgggcgtattagaa
acgacatttaaagaagaaacagaaacagatttgttcggtgagcaagcagttctttgcggc
ggattaagcgcgcttgtcaaagccggatttgaaaccttaactgaagcaggttatcagcct
gaacttgcatacttcgagtgtcttcatgagctgaaattaatcgtagaccttatgtacgaa
gaaggacttgcaggaatgagatattcaatctctgacacagcacagtggggagatttcgta
tcaggccctcgcgttgtggacgccaaagtaaaagaatctatgaaagaagtattaaaagat
atccaaaacggtacattcgcaaaagagtggatcgtcgaaaaccaagtaaaccgtcctcgt
ttcaacgctatcaatgcaagcgagaacgaacatcaaatcgaagtagtgggaagaaagctt
cgtgaaatgatgccgtttgtgaaacaaggcaagaagaaggaagcggtggtctccgttgcg
caaaattaa

DBGET integrated database retrieval system