KEGG   Bacillus subtilis subsp. subtilis 168: BSU28310Help
Entry
BSU28310          CDS       T00010                                 

Gene name
ilvB
Definition
(RefSeq) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00290  Valine, leucine and isoleucine biosynthesis
bsu00650  Butanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU28310 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    BSU28310 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSU28310 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU28310 (ilvB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BSU28310 (ilvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M DXP_synthase_N CO_dh
Motif
Other DBs
NCBI-GeneID: 936792
NCBI-ProteinID: NP_390709
Pasteur: BG10670
BSORF: BG10670
UniProt: P37251
Position
complement(2895248..2896972)
Genome map
AA seq 574 aa AA seqDB search
MGTNVQVDSASAECTQTMSGALMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLVHIL
PRHEQGAIHAAEGYARVSGKPGVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSV
IGSDAFQEADILGITMPVTKHSYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDVAT
IEGEFSYDHEMNLPGYQPTTEPNYLQIRKLVEAVSSAKKPVILAGAGVLHGKASEELKNY
AEQQQIPVAHTLLGLGGFPADHPLFLGMAGMHGTYTANMALHECDLLISIGARFDDRVTG
NLKHFARNAKIAHIDIDPAEIGKIMKTQIPVVGDSKIVLQELIKQDGKQSDSSEWKKQLA
EWKEEYPLWYVDNEEEGFKPQKLIEYIHQFTKGEAIVATDVGQHQMWSAQFYPFQKADKW
VTSGGLGTMGFGLPAAIGAQLAEKDATVVAVVGDGGFQMTLQELDVIRELNLPVKVVILN
NACLGMVRQWQEIFYEERYSESKFASQPDFVKLSEAYGIKGIRISSEAEAKEKLEEALTS
REPVVIDVRVASEEKVFPMVAPGKGLHEMVGVKP
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggggactaatgtacaggtggattcagcatctgccgaatgtacacagacgatgagcgga
gcattaatgctgattgaatcattaaaaaaagagaaagtagaaatgatcttcggttatccg
ggcggggctgtgcttccgatttacgataagctatacaattcagggttggtacatatcctt
ccccgtcacgaacaaggagcaattcatgcagcggagggatacgcaagggtctccggaaaa
ccgggtgtcgtcattgccacgtcagggccgggagcgacaaaccttgttacaggccttgct
gatgccatgattgattcattgccgttagtcgtctttacagggcaggtagcaacctctgta
atcgggagcgatgcatttcaggaagcagacattttagggattacgatgccagtaacaaaa
cacagctaccaggttcgccagccggaagatctgccgcgcatcattaaagaagcgttccat
attgcaacaactggaagacccggacctgtattgattgatattccgaaagatgtagcaaca
attgaaggagaattcagctacgatcatgagatgaatctcccgggataccagccgacaaca
gagccgaattatttgcagatccgcaagcttgtggaagccgtgagcagtgcgaaaaaaccg
gtgatcctggcgggtgcgggcgtactgcacggaaaagcgtcagaagaattaaaaaattat
gctgaacagcagcaaatccctgtggcacacacccttttggggctcggaggcttcccggct
gaccatccgcttttcctagggatggcgggaatgcacggtacttatacagccaatatggcc
cttcatgaatgtgatctattaatcagtatcggcgcccgttttgatgaccgtgtcacagga
aacctgaaacactttgccagaaacgcaaagatagcccacatcgatattgatccagctgaa
atcggaaaaatcatgaaaacacagattcctgtagtcggagacagcaaaattgtcctgcag
gagctgatcaaacaagacggcaaacaaagcgattcaagcgaatggaaaaaacagctcgca
gaatggaaagaagagtatccgctctggtatgtagataatgaagaagaaggttttaaacct
cagaaattgattgaatatattcatcaatttacaaaaggagaggccattgtcgcaacggat
gtaggccagcatcaaatgtggtcagcgcaattttatccgttccaaaaagcagataaatgg
gtcacgtcaggcggacttggaacgatgggattcggtcttccggcggcgatcggcgcacag
ctggccgaaaaagatgctactgttgtcgcggttgtcggagacggcggattccaaatgacg
cttcaagaactcgatgttattcgcgaattaaatcttccggtcaaggtagtgattttaaat
aacgcttgtctcggaatggtcagacagtggcaggaaattttctatgaagaacgttattca
gaatctaaattcgcttctcagcctgacttcgtcaaattgtccgaagcatacggcattaaa
ggcatcagaatttcatcagaagcggaagcaaaggaaaagctggaagaggcattaacatca
agagaacctgttgtcattgacgtgcgggttgccagcgaagaaaaagtattcccgatggtg
gctccggggaaagggctgcatgaaatggtgggggtgaaaccttga

DBGET integrated database retrieval system