KEGG   Bacillus subtilis subsp. subtilis 168: BSU28320Help
Entry
BSU28320          CDS       T00010                                 

Gene name
ysnD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5437
Motif
Other DBs
NCBI-GeneID: 937466
NCBI-ProteinID: NP_390710
Pasteur: BG12335
BSORF: BG12335
UniProt: P94563
Position
2897788..2898123
Genome map
AA seq 111 aa AA seqDB search
MNKSFADMQGFPAGFPSFPNFPQQYYPAVPPFYQQSQQPFGGYGYGQPFSQAYSPLTTPS
GMYSSFPYASGFYGQQFSGAGFSGHGGSLSAPAIHAGGFSGAPGVHGGFRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcatttgcagacatgcaaggatttcctgcgggctttccaagcttccccaac
tttccgcagcagtactatcctgctgtccctcccttttaccagcaaagccagcagccattt
ggaggctacggatacggacagccgttcagtcaggcatacagcccgttaaccactccctct
ggaatgtactcctcattcccatacgcttcaggattttacggacagcaattttcaggtgca
ggctttagcggccatggcggcagcttaagtgctccagcgatacatgccggcggattcagc
ggggcgccaggcgtacacggaggctttagatattaa

DBGET integrated database retrieval system