KEGG   Bacillus subtilis subsp. subtilis 168: BSU28330Help
Entry
BSU28330          CDS       T00010                                 

Gene name
ysnE
Definition
(RefSeq) N-acetyltransferase YsnE
  KO
K03829  putative acetyltransferase [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU28330 (ysnE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU28330 (ysnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_4 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 937464
NCBI-ProteinID: NP_390711
Pasteur: BG12336
BSORF: BG12336
UniProt: P94562
Structure
PDB: 

Position
2898292..2898747
Genome map
AA seq 151 aa AA seqDB search
MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGC
GALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPA
RKLYESFGFQYCEPFADYGEDPNSVFMTKKL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgcatataaaaatagacgatttaactggacgtcaggtggtttcactggtgaatgagcat
ttacatagcatgacgcttatgtccccgccagaaagcattcatgccttaggtctagaaaaa
ctaagagggcctgaaataacattttggagcgcatgggaaggtgatgaactagctggctgc
ggagcgctaaaagaactggacacccggcatggagaaatcaaatcaatgcgaacatctgca
tcacatttaagaaaaggcgttgccaaacaagttctccagcacatcattgaagaagccgag
aagcgaggctatgagcggttaagcttagaaacgggttcaatggcttcatttgagccggca
agaaaattgtatgaaagcttcggtttccagtattgtgaaccgtttgcagactacggtgaa
gatccaaacagtgtgtttatgacgaagaaattgtga

DBGET integrated database retrieval system