KEGG   Bacillus subtilis subsp. subtilis 168: BSU28350Help
Entry
BSU28350          CDS       T00010                                 

Gene name
ysnB
Definition
(RefSeq) metallophosphoesterase
  KO
K07095  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU28350 (ysnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos_2 Metallophos
Motif
Other DBs
NCBI-GeneID: 938021
NCBI-ProteinID: NP_390713
Pasteur: BG12334
BSORF: BG12334
UniProt: P94559
Position
complement(2900020..2900529)
Genome map
AA seq 169 aa AA seqDB search
MNVLIISDSHGLEEELQTIAKRHEAEVDLMIHCGDSELETRHPALEPYAVVKGNCDFAGD
FKDELLLTAGSRKILVTHGHLHGIKQTLLNVYYRAEELGADVICFGHSHIAGSEVLRGKL
MINPGSIRLPRVRRTESYAILTLENDAATVRFYDQAGNEIEDLQNRVTL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgctgattatcagtgacagccatgggcttgaagaagaactccaaaccattgcg
aaacggcatgaggcagaagttgatctcatgattcattgcggggactctgagcttgagacg
aggcatcctgcattggagccttatgcggttgtaaaaggcaattgcgattttgccggcgat
tttaaggacgagcttcttctgactgccggctcaagaaaaatactagtcacacacggccac
cttcacggtataaaacagaccttgttaaacgtatactatcgtgcagaggagctcggggcg
gatgttatctgcttcgggcattcgcacatcgcgggaagcgaagtgctgcgcggaaaactg
atgattaacccaggcagcatccggcttccgagggtgcgcaggacagaaagctatgctata
ctgacattagaaaatgatgctgcgacagtccgtttttacgaccaagcaggcaatgaaatt
gaggatctgcaaaatcgagtcacactatga

DBGET integrated database retrieval system