KEGG   Bacillus subtilis subsp. subtilis 168: BSU28360Help
Entry
BSU28360          CDS       T00010                                 

Gene name
ysnA
Definition
(RefSeq) non-canonical purine NTP pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU28360 (ysnA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BSU28360 (ysnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like EAP30
Motif
Other DBs
NCBI-GeneID: 937465
NCBI-ProteinID: NP_390714
Pasteur: BG12333
BSORF: BG12333
UniProt: P94558
Position
complement(2900545..2901141)
Genome map
AA seq 198 aa AA seqDB search
MIIMKEAIIATHNPGKVKEFKEILEPRGYDVKSLAEIGFTEEIEETGHTFEENAIMKAEA
VAKAVNKMVIADDSGLSIDNLGGRPGVYSARYAGEQKDDQANIEKVLSELKGIEKEQRTA
RFRCALAVSIPGEETKTVEGHVEGYIAEEPRGEYGFGYDPIFIVKDKDKTMAELTSDEKN
KISHRADALKKLSKLLEA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatcatgaaagaagcaattattgcaacacataatccgggaaaagtgaaggaattc
aaagaaattcttgagccaagaggctatgatgtcaaatctttagctgaaattggattcaca
gaggaaattgaagaaacaggccatacatttgaagaaaatgccattatgaaagcggaagct
gttgccaaagcagtgaacaaaatggtgattgcggatgactccggactatccatcgataat
cttggcggcagacccggggtttattcagcccgctatgcaggggaacagaaagacgaccag
gcaaatatcgaaaaagtgctcagcgagctgaaaggtatcgaaaaagaacagcgcaccgcc
cgtttccgctgcgcactggccgtgagtattcccggagaggaaacaaaaacagtcgaaggc
catgttgaagggtatattgctgaagaaccgagaggagaatatggctttggctatgaccca
atttttatcgtgaaagataaagataagacgatggctgaactgacaagtgatgaaaaaaat
aaaatcagccatagggctgacgcgcttaaaaagctgtctaagcttttggaggcataa

DBGET integrated database retrieval system