KEGG   Bacillus subtilis subsp. subtilis 168: BSU28370Help
Entry
BSU28370          CDS       T00010                                 

Gene name
rph
Definition
(RefSeq) ribonuclease PH
  KO
K00989  ribonuclease PH [EC:2.7.7.56]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU28370 (rph)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.56  tRNA nucleotidyltransferase
     BSU28370 (rph)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    BSU28370 (rph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 937463
NCBI-ProteinID: NP_390715
Pasteur: BG10357
BSORF: BG10357
UniProt: P28619
Structure
PDB: 

Position
complement(2901154..2901891)
Genome map
AA seq 245 aa AA seqDB search
MRHDGRQHDELRPITFDLDFISHPEGSVLITAGNTKVICNASVEDRVPPFLRGGGKGWIT
AEYSMLPRATNQRTIRESSKGKISGRTMEIQRLIGRALRAVVDLEKLGERTIWIDCDVIQ
ADGGTRTASITGAFLAMAIAIGKLIKAGTIKTNPITDFLAAISVGIDKEQGILLDLNYEE
DSSAEVDMNVIMTGSGRFVELQGTGEEATFSREDLNGLLGLAEKGIQELIDKQKEVLGDS
LPELK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgacggaagacaacacgatgagctgcgtccaatcacattcgatttggatttt
atcagccatccggaaggttctgttctaataacagcgggaaatacaaaggtaatctgcaac
gcgtctgttgaggaccgcgtaccgccgtttttgcggggcggagggaaaggctggattaca
gcagagtacagcatgctgccgcgggcaacaaaccaaagaacaatcagagaatcttctaag
gggaaaatttccggcagaacaatggagatccaacgcctgatcggccgcgcgcttcgagct
gttgtagatctggaaaagctcggtgaacggacgatttggattgactgtgatgtcattcaa
gctgatggaggaactagaacagcttccattacaggcgcatttcttgctatggcgattgcg
attggcaagctgatcaaagcaggaacaatcaagacaaatccgatcactgattttcttgct
gcaatctctgttggaattgataaggaacagggaattttgttagatttaaattatgaagaa
gattcctctgctgaagttgacatgaatgtcatcatgacaggcagcggccgttttgtggaa
ttgcagggaaccggggaagaggcaactttttctagagaggatctgaacggtcttctgggt
cttgcggaaaaaggaatccaagagctgattgacaagcaaaaagaagtgctgggtgattct
ctgccagaactgaaataa

DBGET integrated database retrieval system