KEGG   Bacillus subtilis subsp. subtilis 168: BSU28380
Entry
BSU28380          CDS       T00010                                 

Gene name
gerM
Definition
(RefSeq) spore germination protein GerM
  KO
K06298  germination protein M
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU28380 (gerM)
SSDB
Motif
Pfam: Germane Pneumo_att_G
Other DBs
NCBI-GeneID: 936490
NCBI-ProteinID: NP_390716
Pasteur: BG10356
BSORF: BG10356
UniProt: P39072 A0A6M4JMG4
Structure
PDB: 
6GZ8 6GZB

Position
complement(2902002..2903102)
AA seq 366 aa
MLKKGPAVIGATCLTSALLLSGCGLFQSDKAAEEIDPPQDVTFVNDEAGANSNTTAAKKT
ESEKSDTAKADQASSTVMRELYLIDKNGYVVAQTLPLPKSESTAKQALEYLVQGGPVSEI
LPNGFRAVLPADTTVNVDIKKDGTAIADFSNEFKNYKKEDEQKIVQSVTWTLTQFSSIDK
VKLRINGHELKEMPVGGTPISDDLSRKDGINLETAGVNDLTATHPLTVYYLAENEDSEYY
VPVTKRIDNSEKDDITAAINELAKGPSKVSGLLTDFSEDVKLVSKPKIKDGRVTLDFNQS
IFGSADEKTKMISSEVLNSIVLTLTEQPDVKSVSVKVNGKSELVNEKGEKLTEPVSRPSQ
VNTGSF
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgctgaaaaaaggacctgcagtcattggtgccacttgtctcacctctgccttgctttta
tccggatgcggtttgtttcaatctgataaggcagccgaggaaattgatccgcctcaagac
gttacattcgtgaacgatgaagcgggtgccaattcaaatacaacagcagccaaaaaaaca
gaaagtgaaaaaagcgataccgcaaaagcggatcaagcctcatctactgttatgagggag
ctttatctcattgataaaaacgggtatgttgttgcgcaaacgctgcctcttcctaaaagt
gagagcacggctaagcaggcgcttgaatacctcgtacagggcgggcctgtgtctgaaatt
cttccgaatggcttcagagctgtattgccggctgacaccaccgttaacgttgacatcaaa
aaagatggaacggcgatagctgatttctctaatgagttcaaaaattataagaaagaagac
gaacagaaaatcgttcaatctgtgacgtggacgctgacgcaatttagttcgatagataaa
gtgaagctgagaataaacgggcatgaactgaaggagatgcctgtaggagggacgccgatc
tcagatgatttaagccgcaaagacggcattaatttggaaacagccggtgtaaatgatctc
actgctacccatccgctgacagtctactatttggcggaaaatgaagacagtgaatactac
gtgccggtgaccaaacgaatcgacaattcggaaaaagacgacatcacagcagccattaat
gaattggctaaagggccgagcaaggtgagcgggctgttaacagacttcagtgaagatgta
aagctggtcagcaaaccgaaaatcaaagacgggcgcgtgacgttggatttcaatcaatct
atattcggcagcgccgatgagaagacgaaaatgatttcttcagaagtgctgaacagcatt
gtgctgacgttaacggagcagccggatgtaaaaagcgtctctgttaaagtgaacggaaaa
tcagagctggtaaatgaaaaaggcgaaaagctcacagaaccggtctccagaccatctcaa
gtgaatacgggtagtttttaa

DBGET integrated database retrieval system