KEGG   Bacillus subtilis subsp. subtilis 168: BSU28390Help
Entry
BSU28390          CDS       T00010                                 

Gene name
racE
Definition
(RefSeq) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00471  D-Glutamine and D-glutamate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU28390 (racE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU28390 (racE)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BSU28390 (racE)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Racemase
   BSU28390 (racE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-GeneID: 935934
NCBI-ProteinID: NP_390717
Pasteur: BG11964
BSORF: BG11964
UniProt: P94556
Structure
PDB: 

Position
complement(2903217..2904035)
Genome map
AA seq 272 aa AA seqDB search
MLEQPIGVIDSGVGGLTVAKEIMRQLPKENIIYVGDTKRCPYGPRPEEEVLQYTWELTNY
LLENHHIKMLVIACNTATAIALDDIQRSVGIPVVGVIQPGARAAIKVTDNQHIGVIGTEN
TIKSNAYEEALLALNPDLKVENLACPLLVPFVESGKFLDKTADEIVKTSLYPLKDTSIDS
LILGCTHYPILKEAIQRYMGEHVNIISSGDETAREVSTILSYKGLLNQSPIAPDHQFLTT
GARDQFAKIADDWFGHEVGHVECISLQEPIKR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgttggaacaaccaataggagtcattgattccggggttggcggtttaaccgttgcgaag
gaaatcatgagacagctacctaaagaaaatattatctacgtcggggatacgaaacggtgt
ccttacgggccgcgccctgaagaagaggtgcttcaatatacgtgggagctgacgaattat
ttactcgaaaaccaccacatcaaaatgctcgtgatcgcctgtaatacagcaacagcgatc
gctttggatgacatccagcgcagcgtcggtataccggtggtcggagtcatccagcctggt
gcgagagcagcgataaaagtgacggataatcagcatatcggtgtcatcggcacagagaat
acgattaagagcaatgcatacgaagaagcgcttttggcattaaaccctgatttgaaggtt
gaaaaccttgcctgcccgctgcttgtgccttttgtggaaagcgggaagtttctcgacaaa
acagcagacgagattgttaaaacctcgctgtatccgttaaaagacacatcaattgattcg
ctgattttaggctgcacccattaccctattttaaaagaagccattcaaagatatatggga
gagcacgtaaacattatttcgtccggcgatgaaacagcccgggaagtcagcacaattctc
tcttataaagggctgctgaaccagtctccgattgccccggatcatcagttcctgacaaca
ggggcgcgtgatcagtttgcaaaaatcgcagacgattggtttggccatgaagtcgggcat
gtggaatgtatctcactgcaagaaccgattaaaagatag

DBGET integrated database retrieval system