KEGG   Bacillus subtilis subsp. subtilis 168: BSU28400Help
Entry
BSU28400          CDS       T00010                                 

Gene name
ysmB
Definition
(RefSeq) MarR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27
Motif
Other DBs
NCBI-GeneID: 937461
NCBI-ProteinID: NP_390718
Pasteur: BG12332
BSORF: BG12332
UniProt: P97247
Position
complement(2904043..2904483)
Genome map
AA seq 146 aa AA seqDB search
MTSKPLEHVADIEKSLRHIAAIIKQKGREILNQYAITPPQFVGLQWLYELGDMTIGELSG
KMYLACSTTTDLIDRMQKNELVERVKDPADRRVVRIHLLPEGERIIQEVITKRQEYLRDM
FESFTDEEIAIFEKSLMKLQHEMKRK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaacctttggagcatgttgcggatattgaaaagtcactccgccacattgcc
gcgatcattaagcaaaaaggacgagaaatccttaaccaatatgcgattacgccgccgcaa
tttgtcggcttgcaatggctttatgaattaggagatatgacaatcggtgaattatcgggc
aaaatgtatctggcatgcagcacgacaacggacttaatcgaccgcatgcaaaaaaatgag
cttgttgagcgggtcaaggacccggcggacagacgtgttgtcaggatacatctgctgcct
gaaggagaacggattatccaagaggtcattacaaaaagacaggaatatctgcgtgatatg
ttcgaatcgtttacagatgaagaaatagccatcttcgaaaaatctttgatgaaactgcag
catgaaatgaagagaaaatga

DBGET integrated database retrieval system