KEGG   Bacillus subtilis subsp. subtilis 168: BSU28410Help
Entry
BSU28410          CDS       T00010                                 

Gene name
gerE
Definition
(RefSeq) spore germination protein GerE
  KO
K01994  LuxR family transcriptional regulator, transcriptional regulator of spore coat protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU28410 (gerE)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    BSU28410 (gerE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Sigma70_r4_2 Sigma70_r4 HTH_10 HTH_11 HTH_40 HTH_23 KORA HTH_Tnp_ISL3 UPF0122 DUF2089 Trans_reg_C HTH_24 HTH_30 Phage_terminase HTH_DeoR Tab2_like HTH_5 Mga HTH_28 HTH_Mga HTH_38 HTH_17
Motif
Other DBs
NCBI-GeneID: 937462
NCBI-ProteinID: NP_390719
Pasteur: BG10355
BSORF: BG10355
UniProt: P11470
Structure
PDB: 

Position
complement(2904727..2904951)
Genome map
AA seq 74 aa AA seqDB search
MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRS
QAVVELLRMGELEL
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagaaagaatttcaatcgaagccgctgctaacgaaaagagaaagagaagtgttc
gaattgctcgttcaagataagacaacaaaggagattgcaagcgagctatttatcagtgag
aaaaccgttcgaaaccatatttcaaatgccatgcagaaattgggtgtgaaagggcgttcg
caagccgttgttgagcttcttagaatgggtgagctagagctttaa

DBGET integrated database retrieval system