KEGG   Bacillus subtilis subsp. subtilis 168: BSU28410
Entry
BSU28410          CDS       T00010                                 

Symbol
gerE
Name
(RefSeq) spore germination protein GerE
  KO
K01994  LuxR family transcriptional regulator, transcriptional regulator of spore coat protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU28410 (gerE)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   LuxR family
    BSU28410 (gerE)
SSDB
Motif
Pfam: GerE Sigma70_r4_2 Sigma70_r4 HTH_10 HTH_11 HTH_40 HTH_23 UPF0122 DUF2089 HTH_30 KORA HTH_Tnp_ISL3 HTH_24 Trans_reg_C Mga HTH_DeoR HTH_5 Tab2_like HTH_Mga Phage_terminase HTH_17 HTH_38 HTH_28
Other DBs
NCBI-GeneID: 937462
NCBI-ProteinID: NP_390719
Pasteur: BG10355
BSORF: BG10355
UniProt: P11470 A0A6M3ZJT6
Structure
PDB: 
1FSE

Position
complement(2904727..2904951)
AA seq 74 aa
MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRS
QAVVELLRMGELEL
NT seq 225 nt   +upstreamnt  +downstreamnt
ttgaaggagaaagaatttcaatcgaagccgctgctaacgaaaagagaaagagaagtgttc
gaattgctcgttcaagataagacaacaaaggagattgcaagcgagctatttatcagtgag
aaaaccgttcgaaaccatatttcaaatgccatgcagaaattgggtgtgaaagggcgttcg
caagccgttgttgagcttcttagaatgggtgagctagagctttaa

DBGET integrated database retrieval system