KEGG   Bacillus subtilis subsp. subtilis 168: BSU28420Help
Entry
BSU28420          CDS       T00010                                 

Gene name
ysmA
Definition
(RefSeq) hypothetical protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU28420 (ysmA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BSU28420 (ysmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2 Acyl-ACP_TE
Motif
Other DBs
NCBI-GeneID: 937652
NCBI-ProteinID: NP_390720
Pasteur: BG10354
BSORF: BG10354
UniProt: P11469
Position
complement(2905067..2905510)
Genome map
AA seq 147 aa AA seqDB search
MKLPAYIDMPFQEWKTSFSFFNKVSVRFSETDMFGHMNNVTPFIYFEEVRISYFKKLNMM
SENKQTMTVVASQQCDYLRQVMPYEELRIYVKTSAVGSSSLTLHYLGENLEGEPCFTGAV
VMVQVSKESGKAVSWTDEEKETLLHTR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcccgcttatattgatatgccgtttcaagaatggaaaacatccttttctttt
ttcaataaggtatccgtaagattttccgagacagacatgtttgggcatatgaataatgta
accccttttatatattttgaggaggtgcggatttcttattttaaaaagctgaatatgatg
agtgaaaacaaacagaccatgacagtcgtggcaagccagcaatgcgattatttgcgccaa
gtcatgccttatgaagagttgcgcatctatgtgaaaacaagcgcagtcggcagttcatct
cttaccttgcactatctcggagagaacctcgaaggcgaaccctgcttcaccggggcagtc
gtgatggttcaagtctcaaaggaaagcggcaaggctgtcagctggacggatgaggagaaa
gaaacgcttcttcatacacgataa

DBGET integrated database retrieval system