KEGG   Bacillus subtilis subsp. subtilis 168: BSU28440Help
Entry
BSU28440          CDS       T00010                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00190  Oxidative phosphorylation
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU28440 (sdhA)
   00650 Butanoate metabolism
    BSU28440 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU28440 (sdhA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BSU28440 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BSU28440 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DAO DUF844 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 937600
NCBI-ProteinID: NP_390722
Pasteur: BG10352
BSORF: BG10352
UniProt: P08065
Position
complement(2906335..2908095)
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGMAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDDRTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIIFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTNIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVNGLESSAEDM
SSSLFDAHVKKEEEKWADIMSMDGTENAYVLHKELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDYPER
NDDEWLKTTMAKHVSPYEAPEFEYQDVDVSLITPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcgacaatt
aaagcagcggaatcaggaatggcggttaaattgttttccatcgttcctgtcaaacgttct
cattcagtttgtgcgcaaggcggcataaacggagcggtcaatacaaaaggggaaggtgac
tctccgtgggaacattttgatgacacggtatacgggggagactttcttgccaaccagccg
ccggtcaaggcgatgtgtgaagcggcgccttcgatcatccacttattagaccggatgggc
gtcatgtttaaccggacgcctgaaggcctgcttgatttccgccgattcgggggtacacag
caccacagaactgcttatgctggtgcgacgacgggacagcagctgctttacgcactggac
gagcaagtgcgcagatacgaagttgcgggtctggtcacaaaatacgaaggctgggaattc
cttggcgctgttttagatgatgacagaacctgccgcggaattgttgcacaaaacctgaca
aacatgcaaattgaatccttccgttcagacgctgtcattatggcgacgggcggaccggga
atcatctttggaaaatcaacgaactccatgattaatacaggatctgctgcgtcaatcgtt
tatcagcagggagcgtattatgcaaacggagaattcattcaaatccacccgacagccata
ccgggcgatgacaaactaagactgatgagtgaatcagcgcgtggtgaaggcgggcgcgtg
tggacatataaagacggcaaaccatggtatttcctggaggaaaaatatccggcatacgga
aacctggtgccgcgtgatattgcgacacgcgaaatatttgatgtgtgtgtgaaccagaag
ctcggtattaacggtgaaaacatggtatatctcgatctgtctcataaagatccgaaagag
cttgatattaagcttggcggcatcattgagatttatgagaaattcatgggagacgacccg
cgtaagcttccaatgaaaatcttcccggcggtccattattctatgggcggtttatgggtg
gattacgatcaaatgacaaatatccctggactgtttgcggctggggaatgtgattattct
atgcacggcggcaaccgcttgggagcgaactccctgctgtctgcgatttacggaggcatg
gtggccggtccgaatgcggtgaaatatgtaaacggcttagaatcttcagcggaagacatg
tcttcatctttattcgacgctcacgttaagaaagaagaagaaaaatgggctgatattatg
agtatggacggaaccgaaaatgcctatgttcttcacaaagagctcggtgagtggatgacg
gcgaacgtaacggttgtccgccataatgacaagcttttgaaaacggatgacaaaattcag
gagttaatggagcgcttcaaaaagatcaacatcaatgacacgacaaaatggagcaaccag
ggagcgatgttcacacgccagttctcgaacatgcttcagcttgcgagggtgattaccctt
ggcgcatacaaccgtaatgaaagccggggcgcccattataaaccggattatcctgaacgt
aatgatgatgaatggctcaaaacaacaatggctaaacatgtaagcccgtatgaagcgccg
gaatttgagtatcaggatgtcgatgtatcactgataacgcctcggaaacgggattactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system