KEGG   Bacillus subtilis subsp. subtilis 168: BSU28450Help
Entry
BSU28450          CDS       T00010                                 

Gene name
sdhC
Definition
(RefSeq) succinate dehydrogenase cytochrome b558 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00190  Oxidative phosphorylation
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU28450 (sdhC)
   00650 Butanoate metabolism
    BSU28450 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU28450 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 937458
NCBI-ProteinID: NP_390723
Pasteur: BG10351
BSORF: BG10351
UniProt: P08064
Position
complement(2908129..2908737)
Genome map
AA seq 202 aa AA seqDB search
MSGNREFYFRRLHSLLGVIPVGIFLIQHLVVNQFAARGAEAFNSAAHFMDSLPFRYALEI
FIIFLPLIYHAVYGVYIAFTAKNNAGQYSYMRNWLFVLQRVTGIITLIFVSWHVWETRIA
AQMGAEVNFDMMANILSSPAMLGFYIVGVLSTIFHFSNGLWSFAVTWGITVTPRSQRIST
YVTLIIFVALSYVGLKAIFAFV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaacagagagttttattttcgaagattgcattccttgcttggcgtcataccg
gtcggcatctttcttattcagcatttagtcgtcaaccagtttgccgcaaggggcgctgaa
gcattcaatagcgctgctcattttatggatagcctgcctttcaggtatgccttggaaatt
tttattatcttcttaccattaatttatcatgcagtttatggtgtgtacatagcgtttact
gcgaaaaataacgccggtcaatacagctacatgagaaactggctattcgtcctgcagcgt
gtaaccggtatcatcaccctcattttcgtcagctggcacgtgtgggaaacccgcattgcc
gcacaaatgggtgctgaggtcaatttcgacatgatggcgaatattttgagctctccggct
atgcttggtttttacattgtcggtgttttatcaacaattttccacttctcgaacggttta
tggtctttcgctgttacatggggcatcacggtaacgcctcgttctcaaagaatttcgaca
tacgttacgctgattatttttgttgcactgtcatacgtaggcttaaaagcgatttttgca
tttgtttaa

DBGET integrated database retrieval system