KEGG   Bacillus subtilis subsp. subtilis 168: BSU28460
Entry
BSU28460          CDS       T00010                                 

Symbol
yslB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2507
Other DBs
NCBI-GeneID: 936806
NCBI-ProteinID: NP_390724
Pasteur: BG11236
BSORF: BG11236
UniProt: P42955 A0A6M3ZEN8
Structure
PDB: 
3NJC

Position
2909030..2909476
AA seq 148 aa
MKSKFEASIDNLKEIEMNAYAYELIREIVLPDMLGQDYSSMMYWAGKHLARKFPLESWEE
FPAFFEEAGWGTLTNVSAKKQELEFELEGPIISNRLKHQKEPCFQLEAGFIAEQIQLMND
QIAESYEQVKKRADKVVLTVKWDMKDPV
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaagtctaaatttgaagcatctattgacaacctaaaagaaattgaaatgaacgcttat
gcctacgaactaatacgagagatcgttctcccagatatgcttggccaagattactcttcc
atgatgtattgggcaggaaaacatctcgcccgtaagtttcctcttgaatcatgggaggaa
tttccggccttctttgaagaagcgggctggggaaccctcaccaacgtaagcgctaaaaaa
caggagcttgaatttgaacttgaagggccgatcatttccaaccggcttaagcatcagaaa
gaaccttgctttcagctggaggctggttttatcgctgaacaaattcaattgatgaatgat
cagattgccgaatcatatgaacaagtgaaaaagagagccgataaagtggttctgactgtg
aaatgggatatgaaagacccagtgtaa

DBGET integrated database retrieval system