KEGG   Bacillus subtilis subsp. subtilis 168: BSU28470Help
Entry
BSU28470          CDS       T00010                                 

Gene name
lysC
Definition
(RefSeq) aspartokinase 2
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00261  Monobactam biosynthesis
bsu00270  Cysteine and methionine metabolism
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU28470 (lysC)
   00270 Cysteine and methionine metabolism
    BSU28470 (lysC)
   00300 Lysine biosynthesis
    BSU28470 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU28470 (lysC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     BSU28470 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT DUF5361 I_LWEQ
Motif
Other DBs
NCBI-GeneID: 937451
NCBI-ProteinID: NP_390725
Pasteur: BG10350
BSORF: BG10350
UniProt: P08495
Position
complement(2909520..2910746)
Genome map
AA seq 408 aa AA seqDB search
MGLIVQKFGGTSVGSVEKIQNAANRAIAEKQKGHQVVVVVSAMGKSTDELVSLAKAISDQ
PSKREMDMLLATGEQVTISLLSMALQEKGYDAVSYTGWQAGIRTEAIHGNARITDIDTSV
LADQLEKGKIVIVAGFQGMTEDCEITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFT
TDPRYVKSARKLEGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSTETEAGTLI
EEESSMEQNLIVRGIAFEDQITRVTIYGLTSGLTTLSTIFTTLAKRNINVDIIIQTQAED
KTGISFSVKTEDADQTVAVLEEYKDALEFEKIETESKLAKVSIVGSGMVSNPGVAAEMFA
VLAQKNILIKMVSTSEIKVSTVVSENDMVKAVESLHDAFELSKHPSAV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttattgtacaaaaattcggaggcacttccgtcggctcagtcgaaaaaattcaa
aatgcggcaaaccgcgcaattgcagaaaaacagaaaggccatcaagtcgttgtcgtcgtt
tcagcaatgggaaaatccactgacgaattggtcagccttgcaaaagctatttctgaccag
ccgagcaaacgcgaaatggatatgctgctggcgacaggcgagcaggtcacgatttcactc
ctttcaatggcattgcaggaaaaaggctatgacgctgtgtcttatactggctggcaggcg
ggaatccgtacggaggccattcacggaaacgccagaattacagatatcgacacttcggtt
ttagcagaccagcttgaaaaaggaaaaattgtcattgttgcaggattccaaggcatgaca
gaggattgtgaaattacgacattgggccggggcggttcagatacaacagcagttgctttg
gctgccgctttaaaagctgataaatgtgacatatacacagacgtgccaggcgtgtttaca
accgatccgcgctatgtgaaatcagcgagaaaacttgagggcatctcatacgatgaaatg
cttgagcttgccaatttaggcgccggtgttcttcatccgagagcagttgagttcgcgaaa
aattaccaagtgccgttagaagtgcgttcaagtacagaaaccgaagcgggaacattaatt
gaggaggaatcatccatggaacagaatttaattgtcagaggcattgcatttgaagatcaa
atcacaagagtaaccatttacgggctgactagcggcctgacaactttgtctactattttt
acaacacttgccaaaagaaacataaacgtggatatcattatccaaacgcaggccgaggac
aagactggaatttccttctctgtcaaaacagaagatgcagaccaaaccgttgcggtgctt
gaagagtataaagacgcgctggaatttgagaaaatcgagacagaaagcaaattggctaaa
gtatctattgttggatccggcatggtctcaaatcccggtgtagcggctgaaatgtttgct
gtactggcgcaaaaaaacattttaatcaaaatggtcagcacatctgaaatcaaagtgtca
acagtcgtaagcgaaaatgacatggtgaaagcagtcgagtcgcttcacgatgcatttgag
ctttcaaaacacccttcagctgtgtaa

DBGET integrated database retrieval system