KEGG   Bacillus subtilis subsp. subtilis 168: BSU28500
Entry
BSU28500          CDS       T00010                                 

Gene name
trxA
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU28500 (trxA)
Chaperones and folding catalysts [BR:bsu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   BSU28500 (trxA)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_3 Thioredoxin_9 TraF HyaE Redoxin Glrx-like Glutaredoxin AhpC-TSA Thioredoxin_7 OST3_OST6 KaiB
Other DBs
NCBI-GeneID: 938187
NCBI-ProteinID: NP_390728
Pasteur: BG10348
BSORF: BG10348
UniProt: P14949 A0A6M3ZI45
Structure
PDB: 
2VOC 2IPA 2GZY 2GZZ

Position
complement(2913024..2913338)
AA seq 104 aa
MAIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDEN
QETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
NT seq 315 nt   +upstreamnt  +downstreamnt
atggctatcgtaaaagcaactgatcaatctttctcagctgaaacaagcgaaggcgtcgta
ctggcagacttctgggctccttggtgcggaccttgtaaaatgattgcacctgttcttgaa
gaattggatcaagaaatgggagacaaactgaaaatcgtaaaaatcgatgtagacgaaaac
caagaaactgccggaaaatacggcgttatgagcatcccgactcttcttgtgttaaaagac
ggcgaagtagttgaaacttcagtcggcttcaaaccaaaagaagcgcttcaagagcttgta
aacaaacatctttaa

DBGET integrated database retrieval system