KEGG   Bacillus subtilis subsp. subtilis 168: BSU28510Help
Entry
BSU28510          CDS       T00010                                 

Gene name
xsa
Definition
(RefSeq) alpha-L-arabinofuranosidase
  KO
K01209  alpha-L-arabinofuranosidase [EC:3.2.1.55]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU28510 (xsa)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     BSU28510 (xsa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-L-AF_C
Motif
Other DBs
NCBI-GeneID: 937449
NCBI-ProteinID: NP_390729
Pasteur: BG11985
BSORF: BG11985
UniProt: P94552
Position
complement(2913661..2915148)
Genome map
AA seq 495 aa AA seqDB search
MSEHQAVIQTDIAKGTINKNIYGHFAEHLGRGIYEGIWVGTDSDIPNINGIRKDVLEALK
QLHIPVLRWPGGCFADEYHWANGVGDRKTMLNTHWGGTIESNEFGTHEFMMLCELLECEP
YICGNVGSGTVQEMSEWIEYMTFEEGTPMSDWRKQNGREEPWKLKYFGVGNENWGCGGNM
HPEYYADLYRRFQTYVRNYSGNDIYKIAGGANVDDFNWTDVLMKKAAGLMDGLSLHYYTI
PGDFWKGKGSATEFTEDEWFITMKKAKYIDELIQKHGTIMDRYDPEQRVGLIIDEWGTWF
DPEPGTNPGFLYQQNTIRDALVAASHFHIFHQHCRRVQMANIAQTVNVLQAMILTEGERM
LLTPTYHVFNMFKVHQDASLLATETMSADYEWNGETLPQISISASKQAEGDINITICNID
HQNKAEAEIELRGLHKAADHSGVILTAEKMNAHNTFDDPHHVKPESFRQYTLSKNKLKVK
LPPMSVVLLTLRADS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacatcaagcagtgattcaaacagatatcgcaaaaggaaccattaacaaaaat
atatacggtcattttgctgagcatttaggaagagggatttatgaggggatctgggtcgga
acggactcagacatccccaatatcaacgggatacgaaaggacgtgctggaggcgctcaaa
cagctgcacattcctgtccttaggtggccgggcgggtgttttgcggacgaataccattgg
gcaaacggtgtcggtgaccgtaagacaatgctgaacactcactggggcggtacaattgaa
tcaaatgaattcggaacgcatgaatttatgatgctttgcgagctgcttgaatgcgagcca
tatatttgcggcaatgtcggaagcggaaccgttcaggaaatgtcggagtggattgagtat
atgacatttgaagaaggcacgccgatgtcagactggagaaagcaaaatggaagagaagag
ccttggaagctgaaatatttcggcgtgggcaatgaaaactggggctgcggcggcaacatg
catcccgaatactacgcagatctgtaccggcgttttcagacttatgtccgcaattacagc
gggaatgacatttataaaattgcaggcggcgcaaatgtggatgattttaattggacggac
gtgcttatgaaaaaagccgctggcctgatggacgggttgagtcttcattattacacgatt
ccgggggatttctggaagggcaaaggatcagccacagaattcacggaagatgaatggttt
attacgatgaaaaaagccaaatacatcgatgaattgattcaaaaacacggcacgattatg
gaccggtacgatccggagcagcgggtcgggctgattattgatgaatggggcacgtggttt
gatcccgagccaggcacgaatcccggtttcttatatcagcaaaacaccattcgtgatgca
ctggtggcggcttctcatttccacattttccatcagcattgccgccgggtgcaaatggcc
aacatcgcccaaacagtaaatgttcttcaagcgatgattttgactgagggagagcggatg
cttttgacaccgacgtaccatgtattcaatatgtttaaggtgcaccaggacgcttctctt
ttagccacagagacaatgtctgccgactatgaatggaacggtgaaacgcttccgcaaatc
agcatttcagcgtcgaaacaagctgaaggcgatatcaatatcacaatttgcaacatcgat
caccaaaacaaagcagaggcggaaatcgagctgaggggcctacacaaggcagcggaccat
tccggagtcattcttacggcagaaaaaatgaatgcgcataacacgtttgacgatcctcat
catgtcaaaccggaatccttcagacaatacacgctcagcaaaaacaaactgaaagtaaaa
ctcccgccaatgtcagtcgtcttacttacgctgcgtgctgattcttaa

DBGET integrated database retrieval system