KEGG   Bacillus subtilis subsp. subtilis 168: BSU28520Help
Entry
BSU28520          CDS       T00010                                 

Gene name
etfA
Definition
(RefSeq) electron transfer flavoprotein subunit alpha
  KO
K03522  electron transfer flavoprotein alpha subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU28520 (etfA)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSU28520 (etfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF ETF_alpha TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 936520
NCBI-ProteinID: NP_390730
Pasteur: BG11934
BSORF: BG11934
UniProt: P94551
Position
complement(2915365..2916342)
Genome map
AA seq 325 aa AA seqDB search
MGKKVIVLGEIRDGELRNVTFEAIAAGRTISGDGEVIGVLIGENVQSIAQELIHYGADKV
LTAEDPKLKTYTADGYSQVMRGVIEQENPDSVIFGHTAMGKDLSPKLAARLQTGLISDAI
DVSVTGGNVVFTRPIYSGKAFERVISTDPMIFATIRPNNIQASEKDTSRSGSIESIDVSL
TDLRTVIQEVVKKTADGVDLSEAKIIVAGGRGVKSKEGFQPLQELAEVLGAAVGASRGAC
DADYCDYALQIGQTGKVVTPDLYIACGISGAIQHLAGMSNSKVIVAINKDPEADIFKIAD
YGIVGDLFEVVPLLTEEFKQLNIHS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaagtgatcgtgcttggagaaatacgcgatggggaattgcgaaatgtcacc
tttgaagcaatagctgcaggaagaaccatttcaggagatggggaagtcatcggtgttctc
atcggtgaaaatgtacaaagcattgcacaagagcttattcattacggagcagataaagtt
cttaccgctgaggacccgaagctgaaaacatacacggcagacgggtacagccaggtcatg
agaggtgttatcgagcaagaaaatcctgattcagtcatcttcgggcatacggcaatgggc
aaggatctttcaccgaagcttgctgcccgtctgcaaacaggcttaatttctgatgctata
gatgtaagcgttaccggagggaatgttgtgttcacacggccgatttactcggggaaagct
tttgaacgcgtcatttcaaccgatccgatgatctttgcaacaattcgccccaataacatt
caagcttcagaaaaagacaccagcagatcggggagcatcgaaagcattgatgtttctctt
actgacctccgcactgttatccaagaggtcgtgaaaaaaacggcggacggtgttgatctc
tccgaagcgaaaattatcgttgcgggcggccgaggagtcaaaagcaaggaaggatttcag
ccgctgcaggagcttgcagaggtgctaggggccgcagtcggggcttctcgcggggcatgt
gacgctgattattgcgattatgctctccaaatcgggcagaccgggaaagtcgttactccg
gatttgtacattgcatgcggcatttccggcgccatccagcatttggccggcatgtcaaac
agcaaggtgatcgtcgccatcaataaagaccccgaagccgatatctttaaaatagcggat
tacggcatcgtcggtgatttatttgaagttgtcccgttattaactgaggaattcaaacag
ctgaatatacactcataa

DBGET integrated database retrieval system