KEGG   Bacillus subtilis subsp. subtilis 168: BSU28530Help
Entry
BSU28530          CDS       T00010                                 

Gene name
etfB
Definition
(RefSeq) electron transfer flavoprotein subunit beta
  KO
K03521  electron transfer flavoprotein beta subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU28530 (etfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF MukB_hinge
Motif
Other DBs
NCBI-GeneID: 937962
NCBI-ProteinID: NP_390731
Pasteur: BG11935
BSORF: BG11935
UniProt: P94550
Position
complement(2916378..2917151)
Genome map
AA seq 257 aa AA seqDB search
MNLFVLMKRTFDTEEKIVIETGKIQDDGAEWIINPYDEYAIEEAIQLKEKHGGTITAVTV
GGEEAEKELRTALAMGCDQAVLINIEDDLDEPDQYSISQVLYHYMKDQEFDLILGGNVAI
DGGSGQVAPRLAELLDIPCITTITKLEINGTDAEAERDVEGDVEKIKTTLPLLVTAQQGL
NEPRYPSLPGIMKAKKKPLEELELDDLDLDEEDAEPKLKTIERFLPPKKEAGKLLQGEPA
EQAKELVSLLRSEAKVI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatctatttgtactgatgaaacggacgtttgacacagaagaaaaaatcgtcattgaa
acaggaaagattcaggatgacggagcggaatggatcattaatccatatgatgagtacgcg
atagaagaagccatccagctgaaggaaaagcatggcggcacgatcaccgctgtcacggtc
ggcggtgaagaagcggagaaagaattgcgtacggcgcttgccatgggttgtgaccaagct
gttttaatcaacatagaagatgatcttgatgaacccgaccaatattccatttctcaagtt
ttataccactatatgaaggatcaggagtttgatttgattctcggcggaaatgttgccatt
gacggaggatcaggacaagtggcgcctcggcttgccgagctactggacattccgtgtatc
actacgatcaccaaactcgaaatcaacggcactgatgcagaagcagaaagggacgtcgaa
ggggatgttgaaaaaatcaaaacgacgctcccattgcttgtcacagctcagcagggctta
aacgagccgcgctatccatcgcttccgggaattatgaaggctaagaaaaagccgcttgaa
gagcttgaacttgatgatcttgatctggacgaagaggatgctgaaccaaagctgaaaacc
attgaacgttttctgccgccgaaaaaagaagccgggaagcttctccaaggtgagcctgct
gaacaggcaaaagagcttgtttcattgctccgcagcgaagctaaagtcatttaa

DBGET integrated database retrieval system