KEGG   Bacillus subtilis subsp. subtilis 168: BSU28550
Entry
BSU28550          CDS       T00010                                 

Gene name
fadR
Definition
(RefSeq) fatty acid metabolism regulator protein
  KO
K13770  TetR/AcrR family transcriptional regulator, fatty acid metabolism regulator protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU28550 (fadR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    BSU28550 (fadR)
SSDB
Motif
Pfam: TetR_C_4 TetR_N TetR_C_24 HTH_Tnp_1_2 TetR_C_11 TetR_C_10 TetR_C_2 TetR_C_5 TetR_C_26 TetR_C_29 HTH_7
Other DBs
NCBI-GeneID: 938105
NCBI-ProteinID: NP_390733
Pasteur: BG12330
BSORF: BG12330
UniProt: P94548 A0A6M3ZF76
Structure
PDB: 
1VI0 3WHB 3WHC

Position
complement(2917957..2918541)
AA seq 194 aa
MKQKRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKE
KMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKIN
EILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALS
NSVLELLVSGIHNK
NT seq 585 nt   +upstreamnt  +downstreamnt
ttgaagcaaaaacggccaaagtatatgcagattattgatgcagcagtagaagtcattgca
gaaaacggctaccaccagtcacaggtatccaaaattgccaaacaagccggggtagcggac
ggcaccatctatctctattttaaaaacaaagaagatattttaatttctcttttcaaagaa
aaaatgggtcaatttattgagcggatggaagaggacattaaagaaaaagcaacagcgaaa
gagaaattggcgcttgtgatttcaaagcatttttcccttttagcgggtgaccataatctc
gccattgtcacgcagcttgagctccgccaatccaacttggagctgcgccaaaaaatcaac
gaaatattaaaaggctacttaaatattttggatggcattttgacggaaggtatacaatca
ggcgaaataaaagaaggcctcgatgtccgcctcgcccggcagatgatttttggaacgatt
gacgaaactgtgacaacttgggtgatgaatgaccaaaagtacgatctcgttgcgctttca
aacagcgttttagaattattggtatccggaattcacaataagtaa

DBGET integrated database retrieval system